DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr22a

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster


Alignment Length:225 Identity:47/225 - (20%)
Similarity:74/225 - (32%) Gaps:92/225 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ISALELLMSTLVFGVTVISLQVFARRHLGIYQRLAALDARLMSDFGANLN--------------- 136
            |..||:||..:.|.:.||.          ||:.|..::.:|: |..:.|.               
  Fly   181 IVQLEVLMVVMHFHLAVIY----------IYRYLWIINGQLL-DMASRLRRGDSVDPDRIQLLLW 234

  Fly   137 -YRKMLRKN---IAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMT 197
             |.::|..|   .|:..|..|:::..:.|  |.:..||     :..:|:..:|            
  Fly   235 LYSRLLDLNHRLTAIYDIQVTLFMATLFS--VNIIVGH-----VLVICWINIT------------ 280

  Fly   198 LAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAMA 262
                   ||.||...|       .|||..:                        :....||..:|
  Fly   281 -------RFSLLVIFL-------LFPQALI------------------------INFWDLWQGIA 307

  Fly   263 H-DLAMS----TSELYILFGQSVGIGQQNE 287
            . |||.|    ||.:..||.....:.|:.|
  Fly   308 FCDLAESTGKKTSMILKLFNDMENMDQETE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 47/225 (21%)
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 47/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.