DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr22c

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:307 Identity:67/307 - (21%)
Similarity:114/307 - (37%) Gaps:91/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILQFL----MGCNG---FGIRRSTFRISWASRIYSMSVAIAAFCCL-------FGSLSVL-LAEE 71
            ||.|.    |.|:|   .||..:..|.|.....:..:..:|.|.|:       :||..|. ||.|
  Fly    53 ILNFFLLLKMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANE 117

  Fly    72 ----------DIRE-RLAKADNLVLS--ISALELLMS--TLVFGVTVISLQVFARRHLGIYQRLA 121
                      .:.| :..|.::.|:.  :|.:.||:|  ::.:|:...:..|          .:.
  Fly   118 LLVLEYQQFASLNETKCPKFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSV----------EMV 172

  Fly   122 ALDARLMSDFGAN---------LNYRKMLRKNIAVLGIVTTIYL-MAINSAAV-QVASGHRALFL 175
            .:::.:...|..|         |.||.:...|..:|.:||.:.| .:::|:.: :..|.:|.|..
  Fly   173 LINSLVQFSFNCNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLE 237

  Fly   176 LFALCYTIVTGGPHFTGYV------HMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQ 234
            |              .||:      ||||....|:....|      ...:|....:   .:.|..
  Fly   238 L--------------KGYMVATYEYHMTLVLTTGLASNFL------AIYSWIVLDI---SMNINF 279

  Fly   235 VVSMIQELHYLIQEINRVYALSLWAAM-AHDLA----MSTSELYILF 276
            :..:|..|..|:...|      ||.:: |.|||    .||..:..||
  Fly   280 IYLLIFPLFLLVNVWN------LWLSIAASDLAENAGKSTQTVLKLF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 61/290 (21%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 67/307 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.