DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr22e

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:450 Identity:86/450 - (19%)
Similarity:146/450 - (32%) Gaps:156/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NGFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLAKADNLVLSISALELLM 94
            :|.|.|:....::....:|. |..:..|...:.|.:..|.    |.:...|...||:.:.:.|::
  Fly     5 SGSGYRQKWTGLTLKGALYG-SWILGVFPFAYDSWTRTLR----RSKWLIAYGFVLNAAFILLVV 64

  Fly    95 STLVFGVTVISLQVFARRHL-----GIY--QRLAALDARLMSDFGAN------------------ 134
            :......|.:.::||.|..|     ||:  |.|:.:...|:..|..:                  
  Fly    65 TNDTESETPLRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYF 129

  Fly   135 LNY---------RKMLRKNIA-VLGIVTTIYL---MAIN-SAAVQVASGHRALFLLFALCYTIVT 185
            .||         |.:|.|..: ||.:|:.:.|   |:.| ||...:..|...|.||     .::.
  Fly   130 RNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSLCLMLL-----AVLL 189

  Fly   186 GGPHF-------TGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQELH 243
            |..||       ..||.:...|:|    :|:.::...|         .|:..|:..::.:...|.
  Fly   190 GASHFHLAVVFVYRYVWIVNRELL----KLVNKMAIGE---------TVESERMDLLLYLYHRLL 241

  Fly   244 YLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYLALVMIPPL 308
            .|.|.:..:|...:...|...|..:...:|.....|:.:.           :.|.:..||.:..|
  Fly   242 DLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLN-----------KSLDFKILVFVQAL 295

  Fly   309 YKLLIAPFYCDRTIYEARRCLRLVEKLDDWF------------PQKSSLRPLVESLMSWRIQAKI 361
                                  ::..||.|.            .|.|::..|...:         
  Fly   296 ----------------------VINMLDFWLNVEICELAERTGRQTSTILKLFNDI--------- 329

  Fly   362 QFTSGLDVVLSRKV----------------IGLF------------TSILVNYLLILIQF 393
               ..:|..|.|.:                .|||            ||.|  |||.||||
  Fly   330 ---ENIDEKLERSITDFALFCSHRRLRFHHCGLFYVNYEMGFRMAITSFL--YLLFLIQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 84/447 (19%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 82/436 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.