DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr36a

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:462 Identity:87/462 - (18%)
Similarity:158/462 - (34%) Gaps:149/462 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVLYFFREPETVFDCAAFICILQFLMGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLS 65
            :.|||::.:                ::|...|.|.....|:..|.|....::||....|:     
  Fly     9 LKVLYYYGQ----------------IIGLINFEIDWQRGRVVAAQRGILFAIAINVLICM----- 52

  Fly    66 VLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFAR--------RHLGIYQRLAA 122
            |||.:      ::|..||.:.......|...::  :.::||::.:.        |......||..
  Fly    53 VLLLQ------ISKKFNLDVYFGRANQLHQYVI--IVMVSLRMASGISAILNRWRQRAQLMRLVE 109

  Fly   123 LDARLMSDFGANLNYRKMLRKNIAV---LGIVTTIYLMAIN---------------------SAA 163
            ...||   |....:.::|.|..|.|   :|:|:....|||:                     ||.
  Fly   110 CVLRL---FLKKPHVKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAI 171

  Fly   164 VQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQ---- 224
            :.:|.....|.:||.            ..|.|:       ::..:.|.:.:.:.|:..:|:    
  Fly   172 INMAISQHYLVILFV------------RAYYHL-------LKTEVRQAIHESQMLSEIYPRRAAF 217

  Fly   225 ----LHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQ 285
                .::.: ||..:..:..:|..::.::|:|:.:............|.:..||.:..::     
  Fly   218 MTKCCYLAD-RIDNIAKLQNQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAI----- 276

  Fly   286 NEEENGSCYRMLGYLALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVE 350
                ||.....|...|..::...:.     ||....|......|:|   .||   .|...|.|.|
  Fly   277 ----NGIEELHLSVRAAALVFSWFL-----FYYTSAILNLFVMLKL---FDD---HKEMERILEE 326

  Fly   351 SLMSWRIQAKIQFTSGLDVVLSR----------------KVIGLFT-----------SILVNYLL 388
            ..:         |||.|||.|.:                :|:.:||           ||:.| .:
  Fly   327 RTL---------FTSALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITN-SI 381

  Fly   389 ILIQFAM 395
            .|||:.|
  Fly   382 FLIQYDM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 83/431 (19%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 87/462 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.