DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr36c

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:410 Identity:92/410 - (22%)
Similarity:153/410 - (37%) Gaps:101/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FLMGC---NGFGIRRSTFRISW-ASRIY----SMSVAIAAFCCLF--------GSLSVLLAEEDI 73
            ||:|.   .|..|..|.|...| ..|::    |...|||...|:|        |:.:::.|   |
  Fly     6 FLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIYHWTGNTNIVNA---I 67

  Fly    74 RERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHLGIYQRLAALD--ARLMSDFGANLN 136
            ..|.......|::|    |....:|.|:..:.|:        .|||...:|  ::::..:.|...
  Fly    68 FGRANMLHEYVVAI----LTGLRIVTGLFTLILR--------WYQRCKMMDLASKVVRMYVARPQ 120

  Fly   137 YRKMLRKNIA---VLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTL 198
            .|:|.|..|.   :.|.:|....||:..:|  :.|.....:|...|.|.:         :|.:.:
  Fly   121 VRRMSRWGILTKFIFGSITDGLQMAMVLSA--MGSVDSQFYLGLGLQYWM---------FVILNM 174

  Fly   199 AEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQEL-----HYLIQEINRVYALSLW 258
            |        ::||.:...|:..:|..::.:   :|||:...::|     |   |.:......|| 
  Fly   175 A--------MMQQHMIMLFVRTQFQLINTE---LRQVIDEAKDLLLSPRH---QGVFMTKCCSL- 224

  Fly   259 AAMAHDLAMSTSELYILFGQ---------SVGIGQQNEEENGSCYRML-----GYLALVMIPPLY 309
            |....::|...|:|..:..|         ::..|.......|:||...     ||..|.|  .|.
  Fly   225 ADQIENIARIQSQLQTIMNQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSM--TLS 287

  Fly   310 KLLIAPFYCDRTIYEARRCLRLVEKL---DDWFPQKSSLRPLVESLMSWRIQAKIQFTSGLDVVL 371
            .:::|..:|  ..|.....|.|...|   ||::          |.|   :|..|.....||||.|
  Fly   288 TVILAYSWC--FFYYLDGMLNLSVMLHVQDDYW----------EML---QILGKRTIFVGLDVRL 337

  Fly   372 SRKVIGLFTSILVNYLLILI 391
            ......|...::.|.|.|.:
  Fly   338 EEAFENLNLQLIRNPLKITV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 88/400 (22%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 90/408 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.