DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr59a

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:406 Identity:78/406 - (19%)
Similarity:146/406 - (35%) Gaps:86/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDI---RERLAKADNLVLSIS 88
            :|...:......||.|..:|||         |.|..::.:.|.....   .:.|:.||.:...:.
  Fly    15 IGMTSYETMGGKFRQSRITRIY---------CLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMR 70

  Fly    89 ALELLMSTLVFGV---TVISLQVFARRHLGIYQRLAALDARLMSDFGANLN--YRKMLRKNIAVL 148
            ....:|.|:.:..   |:|| :.:....|...||:.....|.|...|..:|  .|:|.......|
  Fly    71 VTPYIMCTINYAAIAYTLIS-RCYRDAMLMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTFTL 134

  Fly   149 GIVTTIYLMAI--------------NSAAVQVASGHRALFLLFALCYTIVTGGPHFT-GY--VHM 196
            ......|::|:              |...|.:     :|.:||...:...|...|.. ||  |:.
  Fly   135 TYSCLSYILAVFIYQWKAQNWSNLCNGLLVNI-----SLTILFVNTFFYFTSLWHIARGYDFVNQ 194

  Fly   197 TLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAM 261
            .|.|::..:...|::                :...:|.:.::.:.|.|..:.||:.|...: .||
  Fly   195 QLNEIVACQSMDLER----------------KSKELRGLWALHRNLSYTARRINKHYGPQM-LAM 242

  Fly   262 AHDLAMSTSELYILF---GQSVGIGQQNEEENGSCYRMLGYLALVMIPPLYKLLIAPFYCDRTIY 323
            ..|        |.:|   ...:|......::..|..::.|  :|:.....:...:..:.||    
  Fly   243 RFD--------YFIFSIINACIGTIYSTTDQEPSLEKIFG--SLIYWVRSFDFFLNDYICD---- 293

  Fly   324 EARRCLRLVEKLD---DWFPQKSSLRPLVESLMSWRIQAKIQ-FTSGLDVVLSRKVIGLFTSILV 384
                   ||.:..   .:|..:||:...:.|.:.:....::. ...||..|..||.:.:..||:|
  Fly   294 -------LVSEYQMQPKFFAPESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVV 351

  Fly   385 NYLLILIQFAMTQKMG 400
             :..:|.||.:..:.|
  Fly   352 -HSSMLFQFHLVMRGG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 76/396 (19%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 77/401 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.