DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr92a

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:433 Identity:86/433 - (19%)
Similarity:157/433 - (36%) Gaps:137/433 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVLYFF----REPETVFDCAAFICILQFLMGCNGFGIRRSTF-RISWASRIYSMSVAIAAFCCL 60
            :.|::|.    ::.:|||       |..:|...| ...|..|| |..|   :|..|::|.     
  Fly    28 IGVIFFCLHTRKDDKTVF-------IRNWLKWLN-VTHRIITFTRFFW---VYIASISIK----- 76

  Fly    61 FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVF-GVTVISLQVFARRHLGIYQRLAALD 124
              :..||.....:|        |||||..:.:::...:| |..:|.|   ..:.|.::::::.|.
  Fly    77 --TNRVLQVLHGMR--------LVLSIPNVAVILCYHIFRGPEIIDL---INQFLRLFRQVSDLF 128

  Fly   125 ARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQ------VASGHRALFLLFALCYTI 183
            ......||..       |:.|.:|       |..|:.|..|      :..|....||:...|...
  Fly   129 KTKTPGFGGR-------RELILIL-------LNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFY 179

  Fly   184 VTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQEL-------RIRQVVSMIQE 241
            :....:.  ::|:.....|.:.. |..:|.:..:.|.|   :.:|:|       :||:|.:.:::
  Fly   180 LVSATNI--FIHINSIGYLSLGV-LYSELNKYVYTNLR---IQLQKLNTSGSKQKIRRVQNRLEK 238

  Fly   242 LHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYLALVMIP 306
            ...|.:||   |..|:   |.|.|                                 ::.|:.:.
  Fly   239 CISLYREI---YHTSI---MFHKL---------------------------------FVPLLFLA 264

  Fly   307 PLYKLLI---------APFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQ---- 358
            .:||:|:         ..||.:..|:    .:.|.:.:.|.|....|:...|...::..:|    
  Fly   265 LIYKVLLIALIGFNVAVEFYLNSFIF----WILLGKHVLDLFLVTVSVEGAVNQFLNIGMQFGNV 325

  Fly   359 ---AKIQFTSGLDVVLSR--------KVIGLFTSILVNYLLIL 390
               :|.|.|  ||.:...        .::|||....:.||..|
  Fly   326 GDLSKFQTT--LDTLFLHLRLGHFRVSILGLFDVTQMQYLQFL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 78/398 (20%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 86/433 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.