DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr22f

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:457 Identity:90/457 - (19%)
Similarity:157/457 - (34%) Gaps:160/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EPETVFDCAAFICILQ------FLMGCNGF-------GIRRSTFRISWASRIYSMSVAIAAFCCL 60
            :|...|.|.....:||      :|:|...|       .::||.:.:.:...::|:::.:|     
  Fly     5 QPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLA----- 64

  Fly    61 FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHL--GIYQRLAAL 123
               :|..||.:..|:..|...|.:|....::..::|. |.::|:.|....:.:.  .|...|..|
  Fly    65 ---MSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTF-FTISVLLLMNVWKSNTVRKIANELLTL 125

  Fly   124 DAR----LMSDFGANLNYRKMLRKNIAVLG-IVTTIYLMAINSAAVQVASGHRALFLLFALCYTI 183
            :.:    |......|.|. .:::|::|.:| .|.:||                     |.||.  
  Fly   126 EGQVKDLLTLKNCPNFNC-FVIKKHVAAIGQFVISIY---------------------FCLCQ-- 166

  Fly   184 VTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQE------- 241
                       ..:..::|.|...|....||...:::     |.:.:.:.:.|.::.|       
  Fly   167 -----------ENSYPKILKILCCLPSVGLQLIIMHF-----HTEIILVYRYVWLVNETLEDSHH 215

  Fly   242 -----LHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSV--------GIGQQNEEENGSC 293
                 :|.|....:|:..||......:||.:....:..|.|.:|        |:.....      
  Fly   216 LSSSRIHALASLYDRLLKLSELVVACNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKR------ 274

  Fly   294 YRMLGYLALVMIPPLYKLLIAPFY--------CDRTIYEARRC-------LRLVEKL--DDWFPQ 341
                 |:.||..|.    ||..|:        ||.    |.:|       |:|...|  ||    
  Fly   275 -----YIYLVASPQ----LIINFWDFWLNIVVCDL----AGKCGDQTSKVLKLFTDLEHDD---- 322

  Fly   342 KSSLRPLVESL--MSWR-IQAKIQFTSGLDVVLSRKVIGLF------------TSILVNYLLILI 391
                ..|..||  .:|. ...|.:|          ::.|||            ||.|  ||:.|:
  Fly   323 ----EELERSLNEFAWLCTHRKFRF----------QLCGLFSINHNMGFQMIITSFL--YLVYLL 371

  Fly   392 QF 393
            ||
  Fly   372 QF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 83/428 (19%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 87/443 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.