DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr39a

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:433 Identity:83/433 - (19%)
Similarity:163/433 - (37%) Gaps:101/433 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DCAAFICILQFL-MGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLA 78
            :..|:..:.::| :.|..:...:..||:..:...|.:..|:.|:  |.|.:||::.   ...|..
  Fly     7 ELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY--LVGCISVMVT---YWRRCF 66

  Fly    79 KADNLVLSISALELLMSTLVFGVTVI-----------------SLQVFARRHLGIYQRLAALDAR 126
            |:: |..:.:..:.|:..:..|:.|:                 .::.:.|.||.           
  Fly    67 KSE-LTTTGNHFDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLA----------- 119

  Fly   127 LMSDFGANLNYRKMLRKNIAVLGIVTTIYLMA--INSAAVQVASGHRALFLL----FALCY--TI 183
                     |.|.:|.|.:..|.|.|.:..||  |.:...:..:....||::    |.|.|  |.
  Fly   120 ---------NVRLLLPKRLLWLIIATNVVYMANFIKTCIFEWLTDASRLFVITSLGFPLRYLVTS 175

  Fly   184 VTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHV-------------QELRIRQV 235
            .|.|.:|. .||:.         ||:        |:|...|::.             ..||:|..
  Fly   176 FTMGTYFC-MVHIV---------RLV--------LDWNQSQINAIIDESADLKMTSPNRLRLRVC 222

  Fly   236 VSMIQELHYLI-QEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGY 299
            :.|...|..|. .||:.||....|.:........|..:|:.        ...:.:.....:::  
  Fly   223 LEMHDRLMLLCNDEISLVYGFIAWLSWMFASLDVTGVIYLT--------MVIQTKKSIVLKLI-- 277

  Fly   300 LALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQK-SSLRPLVESLMSWRIQAKIQF 363
            ..:|.:.|.:....|.|..:|...:|.:..:::.|:    |:. :.|..::|..:...::.|...
  Fly   278 TNVVWLSPTFMTCAASFMSNRVTIQANKTAKMLTKV----PRTGTGLDRMIEKFLLKNLRQKPIL 338

  Fly   364 TS-GLDVVLSRKVIGLFTSILVNYLLILIQFAMTQKMGEQIEQ 405
            |: |...:....:..|||:|. .|::||:||...:...:.|.:
  Fly   339 TAYGFFALDKSTLFKLFTAIF-TYMVILVQFKEMENSTKSINK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 79/405 (20%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 82/422 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.