DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr47b

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_725040.2 Gene:Gr47b / 117345 FlyBaseID:FBgn0041241 Length:414 Species:Drosophila melanogaster


Alignment Length:388 Identity:83/388 - (21%)
Similarity:160/388 - (41%) Gaps:39/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERL-AKADNLVLSISALELLMSTLV 98
            |...|...| :..|::........|...::...|.:.::...: .....||.:|...|.|..::.
  Fly    33 RGGAFSNRW-TVCYALFTRSFMVICFMATVMTKLRDPEMSAAMFGHLSPLVKAIFTWECLSCSVT 96

  Fly    99 FGVTVISLQVFARRHLGIYQRLAALDARLMSDF-GANLNYRKMLRK---NIAVLGIVTTIYLMAI 159
            :....:||.:...|||.:..|:...|..::..| ....|||:...|   ...::|.....:.:::
  Fly    97 YIEYCLSLDLQKDRHLKLVARMQEFDRSVLMVFPHVQWNYRRARLKYWYGTVIVGFCFFSFSISL 161

  Fly   160 NSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQ 224
            .....:...|..:. ||.|..||::|......|:||:.:.:.:.:|.||:||||...:......:
  Fly   162 IFDTTRCTCGIPST-LLMAFTYTLLTSSVGLLGFVHIGIMDFIRVRLRLVQQLLHQLYQADDSSE 225

  Fly   225 LHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEE 289
            :|.   ||..:..|.:...:|:.|:|.|:..:..|.:.:|..:.|..:|::              
  Fly   226 VHE---RIAYLFEMSKRCSFLLAELNGVFGFAAAAGIFYDFTIMTCFVYVI-------------- 273

  Fly   290 NGSCYRMLG---------YLALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSL 345
               |.::|.         |:.|.:....||::|...|....:.|.|.|:.|:.:...:|..:...
  Fly   274 ---CQKLLEREPWDPEYVYMLLHVAIHTYKVVITSTYGYLLLREKRNCMHLLSQYSRYFSGQDVA 335

  Fly   346 RPLVESLMSWRIQAKIQFTSGLDVVLSRKVIGLFTSILVNYLLILIQFAMTQKMGEQIEQQKI 408
            |...|....||:..:.....|...:||...|.|..:.:.||::||:|....|   :||:..::
  Fly   336 RRKTEDFQHWRMHNRQAAMVGSTTLLSVSTIYLVYNGMANYVIILVQLLFQQ---QQIKDHQL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 80/375 (21%)
Gr47bNP_725040.2 7tm_7 14..322 CDD:303125 64/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F79W
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019954
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.