DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr98b

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:390 Identity:83/390 - (21%)
Similarity:145/390 - (37%) Gaps:133/390 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LMSTLVFGVTVISLQVFARRHLGIYQRLAALDARLM----SDFG----------------AN--- 134
            ||:..||..|.|...||    :..|..:.|:|..::    |||.                ||   
  Fly    43 LMTGYVFYATAILATVF----IVSYFNIIAIDEEVLEYNVSDFTRVMGNIQKSLYSIMAIANHLN 103

  Fly   135 --LNYRKM--LRKNIAVLGIVTTIYLMAINSAAVQVASGHRALF---LLFALCYTI-----VTGG 187
              :|||::  :.|:||.|.       |.::.|: |...|.|..|   ...|||..:     |...
  Fly   104 MLINYRRLGGIYKDIADLE-------MDMDEAS-QCFGGQRQRFSFRFRMALCVGVWMILMVGSM 160

  Fly   188 PHFT----GYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQE--LRIRQVVSMIQELHYLI 246
            |..|    |....||.::|.....::|||...|:..:   .|.:.|  ||:|:.:|.:||.....
  Fly   161 PRLTMTAMGPFVSTLLKILTEFVMIMQQLKSLEYCVF---VLIIYELVLRLRRTLSQLQEEFQDC 222

  Fly   247 QEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYLALVMIPPLYKL 311
            ::.:.:.||.        :|:..::|.:                |..:|:.|.:.....|.:..|
  Fly   223 EQQDMLQALC--------VALKRNQLLL----------------GRIWRLEGDVGSYFTPTMLLL 263

  Fly   312 ----------LIAPFYCDRTIYE------------------------ARRCL-------RLVEKL 335
                      ::...|.::.:|:                        ::||:       |::.|:
  Fly   264 FLYNGLTILHMVNWAYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKI 328

  Fly   336 DDWFPQKSSLRP----LVESLMSWRIQ---AKIQFTSGLDVVLSRKVIGLFTSILVNYLLILIQF 393
                 :.:|..|    |...|..:.:|   .|::||.|....::.|..|.....:..|::|||||
  Fly   329 -----RCTSADPNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQF 388

  Fly   394  393
              Fly   389  388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 83/390 (21%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 83/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.