DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exu and trex3

DIOPT Version :9

Sequence 1:NP_001163218.1 Gene:exu / 37345 FlyBaseID:FBgn0000615 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005174272.1 Gene:trex3 / 101886651 ZFINID:ZDB-GENE-131127-357 Length:244 Species:Danio rerio


Alignment Length:167 Identity:42/167 - (25%)
Similarity:79/167 - (47%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LVGVDIDTTGRRLMD----EIVQLAAYTPTDHFEQYIMPYMNLNPAARQRHQVRVISI---GFYR 92
            ||..|::|||   :|    :||||:|.:....|..|::|...:...|.|     |..:   |...
Zfish    57 LVFFDLETTG---LDTSRCDIVQLSAISGAQVFSVYLLPRCCITEGASQ-----VTGLWVDGSTL 113

  Fly    93 MLKSMQTYKIIKSKSEIAALKDFLNWLEQLKTKAGPSSDGIVLIYHEERKFIPYMILESLKKYGL 157
            ||:.    :.:::.....||..|:.:| |.:|...|     :|:.|..|:|...::...|:::||
Zfish   114 MLRE----RPVQTVPHQQALTGFIRFL-QNQTFGRP-----ILVGHNSRRFDWPILRRVLEEFGL 168

  Fly   158 LERFTASVKSFANSINLAKASIGDANIKNYSLRKLSK 194
            |:.|.:......::::|::....:|      |:|.|:
Zfish   169 LQEFRSCASECVDTLSLSREMFRNA------LQKFSQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exuNP_001163218.1 None
trex3XP_005174272.1 DnaQ 54..244 CDD:223916 42/167 (25%)
DEDDh 58..228 CDD:176648 41/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.