DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exu and Trex1

DIOPT Version :9

Sequence 1:NP_001163218.1 Gene:exu / 37345 FlyBaseID:FBgn0000615 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001020160.1 Gene:Trex1 / 100049583 RGDID:1311998 Length:316 Species:Rattus norvegicus


Alignment Length:122 Identity:33/122 - (27%)
Similarity:48/122 - (39%) Gaps:24/122 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 EGLDIALQSIGRLKSKDKAELLELLDSYFDPKKTTVKPVVKGNSNNNNNYRRRNRRGGRQSVKDA 433
            ||..:||.||.:.|.:   .||:.:|.:..| .:|:||:          |......|.......|
  Rat   198 EGDVLALLSICQWKPQ---ALLQWVDKHARP-FSTIKPM----------YGMAATTGTASPRLCA 248

  Fly   434 RPSSSPSASTEFGAGGDKSRSVSSLPDSTTKTPSPNKPRMHRKRNSRQSLGATPNGL 490
            ..:|||.|:........:||.         |.|:...|....:..||:.|.| |.||
  Rat   249 ATTSSPLATANLSPSNGRSRG---------KRPTSPPPENVPEAPSREGLLA-PLGL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exuNP_001163218.1 None
Trex1NP_001020160.1 TREX1_2 14..211 CDD:99839 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.