DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exu and trex4

DIOPT Version :9

Sequence 1:NP_001163218.1 Gene:exu / 37345 FlyBaseID:FBgn0000615 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001373584.1 Gene:trex4 / 100005742 ZFINID:ZDB-GENE-110411-9 Length:235 Species:Danio rerio


Alignment Length:158 Identity:39/158 - (24%)
Similarity:72/158 - (45%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DIDTTGRRLMDEIVQLAAYTPTDHFEQYIMPYMNLNPAARQRHQVRVISIGFYRMLKSMQTYKII 103
            |::|||.....|||||||.:....|..:::|   ..|..|...::...|:...|:....:.   :
Zfish    16 DLETTGLDSSCEIVQLAAVSGGHTFNLFMVP---RRPFQRGASRITGFSVKHQRLFLHRRP---L 74

  Fly   104 KSKSEIAALKDFLNWLEQLKTKAGPSSDGIVLIYHEERKFIPYMILESLKKYGLLERFTASVKSF 168
            .:.|...||..|:::|..|        |..:|:.|..|:|...::..:|.::.|...|...|..|
Zfish    75 LTSSLKEALLSFISFLRML--------DHPLLLGHNIRRFDCPVLARALDEFSLRSHFQREVSGF 131

  Fly   169 ANSINLAKASIGDANIKNYSLRKLSKIL 196
            .:::.||:..:.|..::::....|.|.|
Zfish   132 VDTLPLARQLLKDHGLQSFKQESLVKNL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
exuNP_001163218.1 None
trex4NP_001373584.1 DEDDh 13..181 CDD:176648 39/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.