DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fem-1 and AT1G03670

DIOPT Version :9

Sequence 1:NP_611508.1 Gene:Fem-1 / 37344 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_171863.1 Gene:AT1G03670 / 839438 AraportID:AT1G03670 Length:616 Species:Arabidopsis thaliana


Alignment Length:412 Identity:91/412 - (22%)
Similarity:156/412 - (37%) Gaps:98/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AARSGQMLSFVEILN---SVSCRAVQTHLVNTNFDQPDGQSLTPLTMAAMMGNVKFVKTLLSHYD 125
            |.|:|..:|.::.:|   .|:.|.|            |.|..:.|.:||.:|:|..|:.::|.:.
plant    44 AVRAGDKVSLLKRINDDVKVTQRLV------------DNQGNSILHIAAALGHVHIVEFIISTFP 96

  Fly   126 VDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQ-------AGAAINHNTKAQSSPLRAA 183
             :|.:..|::       |.|.|.|||..|.|.||::||:       ..|.|...:|...:.|.||
plant    97 -NLLQNVNLM-------GETTLHVAARAGSLNIVEILVRFITESSSYDAFIAAKSKNGDTALHAA 153

  Fly   184 CYEGRLDIVEFLIDNGADVNATNLFNNNT-----LMIAAYKGHHLVVKTLLQNGSRANDQA--LC 241
            .....:::...|:....||:    |:.|.     |.:|...|:|.:|..:|::.|..:..|  ..
plant   154 LKGKHVEVAFCLVSVKHDVS----FDKNNDEASPLYMAVEAGYHELVLKMLESSSSPSILASMFS 214

  Fly   242 GATALHYAAESGHLDV--VVALLDHGATLKKNEL------------------------------- 273
            |.:.:|.|.::...|:  :|...|.|....:||.                               
plant   215 GKSVIHAAMKANRRDILGIVLRQDPGLIELRNEEGRTCLSYGASMGCYEGIRYILAEFDKAASSL 279

  Fly   274 -------GITPALQAAERLHEDVLEAFIER-PELMS-LEEQITALELLGATYANDKI-----KYD 324
                   |.||...||:..|..:::.|::. |:... |..|...:..:.|.....|:     |.|
plant   280 CYVADDDGFTPIHMAAKEGHVRIIKEFLKHCPDSRELLNNQCQNIFHVAAIAGKSKVVKYLLKLD 344

  Fly   325 VNKAYGYLLRAMQLRYSNPRGVIRKRVQPTVPAYDNWLETENLPELYAIKLNHHSIHMESLAIRE 389
            ..|.   ::....:..:.|..:..|...|.|.....|.:..||.     .||:..  ..:|.|.|
plant   345 EGKR---MMNEQDINGNTPLHLATKHRYPIVVNMLTWNDGINLR-----ALNNEG--FTALDIAE 399

  Fly   390 RILGRNNPELPQAIIYRGAVMA 411
            .:...|...|.:.:|:...|.|
plant   400 TMKDNNAYVLYKRLIWMALVSA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 37/141 (26%)
ANK repeat 103..129 CDD:293786 7/25 (28%)
Ank_2 105..206 CDD:289560 30/107 (28%)
ANK 142..262 CDD:238125 36/135 (27%)
ANK repeat 142..173 CDD:293786 14/37 (38%)
ANK repeat 178..206 CDD:293786 6/27 (22%)
Ank_2 180..266 CDD:289560 22/94 (23%)
ANK repeat 208..239 CDD:293786 9/35 (26%)
ANK repeat 241..266 CDD:293786 6/26 (23%)
Ank_4 244..294 CDD:290365 14/89 (16%)
ANK 548..685 CDD:238125
ANK repeat 548..594 CDD:293786
ANK repeat 596..636 CDD:293786
AT1G03670NP_171863.1 ANK repeat 40..69 CDD:293786 8/36 (22%)
ANK repeat 72..103 CDD:293786 8/31 (26%)
Ank_2 76..172 CDD:372319 28/103 (27%)
ANK repeat 105..143 CDD:293786 14/44 (32%)
ANK repeat 145..173 CDD:293786 5/27 (19%)
ANKYR <214..364 CDD:223738 25/152 (16%)
ANK repeat 214..246 CDD:293786 7/31 (23%)
ANK repeat 248..284 CDD:293786 0/35 (0%)
ANK repeat 286..318 CDD:293786 8/31 (26%)
Ank_2 291..376 CDD:372319 16/87 (18%)
ANK repeat 320..354 CDD:293786 6/36 (17%)
PGG 443..553 CDD:372845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.