DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fem-1 and AT4G03480

DIOPT Version :9

Sequence 1:NP_611508.1 Gene:Fem-1 / 37344 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_192257.5 Gene:AT4G03480 / 827906 AraportID:AT4G03480 Length:659 Species:Arabidopsis thaliana


Alignment Length:393 Identity:96/393 - (24%)
Similarity:149/393 - (37%) Gaps:103/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DEAHTSIY-----DGYPPDFGYFNMAHGMLVEISE--EIRAKFPHEPRLRFSQLNNLHLAARSGQ 69
            |....:||     ||..|       .|..|.::.|  |:.....::.|:|...|::|.:..|..:
plant   225 DRDRLNIYVLKDIDGDTP-------LHAALKDLHEKAEVSHLLRYQERIRKLSLSHLIMHWRRSR 282

  Fly    70 MLSFVEILNSVSCRAVQTHLVNTNFDQ-------PDGQSLTPLTMAAMMGNVKFVKTLLS----- 122
            .:||    :..|.|.::|.....|.||       .||.|  ||.:|...|||..|:.:|:     
plant   283 CISF----SDASTRQMETAACLVNADQHASFLANKDGTS--PLYLAVEAGNVSLVRAMLNRPGNK 341

  Fly   123 --------------------------HYDVDLDRECNVIY--DGMVV-----YGATALWVAAGMG 154
                                      :.||     .|||.  |..:|     .|.|.|.|.|.||
plant   342 IQGKTSTLASQLEGRKSLLHAALKAKNTDV-----LNVILNDDPSLVNERDEEGRTCLSVGASMG 401

  Fly   155 HLQ-IVKMLVQAGAAINHNTKAQSSPLRAACYEGRLDIVEFLIDNGAD-VNATNLFNNNTLMIAA 217
            :.: |.|:|.::..::....|..|.|:..|..:|.|.:|:.::....| ....|....|.|.|||
plant   402 YYKGICKLLDRSTKSVYECDKDGSFPIHMAVEKGHLKVVKEILKRCPDSKELVNKQGQNMLHIAA 466

  Fly   218 YK---GHHLV--VKTLLQNGSRANDQALCGATALHYAAESGHLDVVVALLDHGATLKK-----NE 272
            ..   |..|:  ::.|........:|.:.|...||.|..:.....|..|....:|..|     |:
plant   467 KSAKVGSFLLGYIRRLDTENHLIEEQDVDGNAPLHLATINWRCRTVDKLAAFASTETKILNIQNK 531

  Fly   273 LGITPALQAAERLHEDVLEAFIERPELMSLEEQITALELLGATYANDKIKYDVNKAYGYL-LRAM 336
            .|:.|.         |:.|..:: |:.: |.|::|.:.|| ..||        .|:.|:| ...|
plant   532 DGLRPL---------DIAELNLQ-PDYV-LRERLTLMVLL-CVYA--------PKSVGWLPTSGM 576

  Fly   337 QLR 339
            .||
plant   577 TLR 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 45/180 (25%)
ANK repeat 103..129 CDD:293786 10/56 (18%)
Ank_2 105..206 CDD:289560 32/140 (23%)
ANK 142..262 CDD:238125 33/126 (26%)
ANK repeat 142..173 CDD:293786 10/31 (32%)
ANK repeat 178..206 CDD:293786 6/28 (21%)
Ank_2 180..266 CDD:289560 21/91 (23%)
ANK repeat 208..239 CDD:293786 8/35 (23%)
ANK repeat 241..266 CDD:293786 6/24 (25%)
Ank_4 244..294 CDD:290365 12/54 (22%)
ANK 548..685 CDD:238125
ANK repeat 548..594 CDD:293786
ANK repeat 596..636 CDD:293786
AT4G03480NP_192257.5 ANK 157..335 CDD:238125 33/122 (27%)
Ank_4 157..211 CDD:290365
ANK repeat 190..236 CDD:293786 3/10 (30%)
Ank_2 <310..387 CDD:289560 18/83 (22%)
ANK 312..444 CDD:238125 35/138 (25%)
ANK repeat 314..344 CDD:293786 11/31 (35%)
ANK repeat 358..387 CDD:293786 7/33 (21%)
Ank_2 360..449 CDD:289560 24/93 (26%)
ANK 384..515 CDD:238125 33/130 (25%)
ANK repeat 389..421 CDD:293786 10/31 (32%)
ANK repeat 423..448 CDD:293786 6/24 (25%)
Ank_2 428..515 CDD:289560 20/86 (23%)
PGG 588..>659 CDD:290670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.