DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fem-1 and Ankrd46

DIOPT Version :9

Sequence 1:NP_611508.1 Gene:Fem-1 / 37344 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001344935.1 Gene:Ankrd46 / 68839 MGIID:1916089 Length:228 Species:Mus musculus


Alignment Length:137 Identity:41/137 - (29%)
Similarity:67/137 - (48%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NTKAQSS-PLRAACYEGRLDIVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRA 235
            |..:|:: ||..||.:|.....:.|:::|.|.|..:......|.:||.:|:..:.:.|.:.|:..
Mouse     7 NDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADP 71

  Fly   236 NDQALCGATALHYAAESGHLDVVVALLDHGATLK-KNELGITPALQAAER-LHEDVLEAFIERPE 298
            ......|.||||..   ||:|.:..|:.:|..:. .|..|.||.:.|..| :::||:..      
Mouse    72 LATDYQGNTALHLC---GHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRL------ 127

  Fly   299 LMSLEEQ 305
            |.|||||
Mouse   128 LESLEEQ 134

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 7/24 (29%)
ANK repeat 103..129 CDD:293786
Ank_2 105..206 CDD:289560 11/34 (32%)
ANK 142..262 CDD:238125 25/90 (28%)