DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fem-1 and LONRF2

DIOPT Version :9

Sequence 1:NP_611508.1 Gene:Fem-1 / 37344 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_940863.3 Gene:LONRF2 / 164832 HGNCID:24788 Length:754 Species:Homo sapiens


Alignment Length:461 Identity:89/461 - (19%)
Similarity:147/461 - (31%) Gaps:163/461 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LQNGS---RANDQALCGATALHYAAESGHLDVVVALLDHGATLKKNELGITPALQAAERLHEDVL 290
            |:.|.   ||.|..:  |..|..:..:|     :|..|.|..|:..:     ||..|.||.| .|
Human    27 LEEGDEAFRAGDYEM--AAELFRSMLAG-----LAQPDRGLCLRLGD-----ALARAGRLPE-AL 78

  Fly   291 EAFIERPELMSLEEQITALELLGATYANDKIKYDVNKAYGYLLRAMQLR-----YSNPRGVIRKR 350
            .||.....|.:|..:                  ::.:..|.|:||:.||     ..||.|     
Human    79 GAFRGAARLGALRPE------------------ELEELAGGLVRAVGLRDRPLSAENPGG----- 120

  Fly   351 VQPTVPAYDNWLETENLPELYA----------IKLNHHSIHME-SLAIRERILGRNNPELPQAII 404
             :|..|.     |....||..|          .:|.|..:.:. .|.:.:|.: ...|..||.  
Human   121 -EPEAPG-----EGGPAPEPRAPRDLLGCPRCRRLLHKPVTLPCGLTVCKRCV-EPGPARPQV-- 176

  Fly   405 YRGAVMADQGRFYQCQVLWNYAIDLRMRNNVSVDRDLLRFAQLFAQILRVENHNLTLDHVLPVLA 469
             |...:...|...:|     :..:.|:|......|.|.|..|..|.:||                
Human   177 -RRVNVVLSGLLEKC-----FPAECRLRRLAGQARSLQRQQQPEAALLR---------------- 219

  Fly   470 KCQQEIENNKFKIKEAKPNACPSLWQDQNNQNCITALYLIKIVTHLARRKKDQNIDEEHIQQLFL 534
             |.|.:|                |..|.|      :|.|::...:|..:..:|.:.:        
Human   220 -CDQALE----------------LAPDDN------SLLLLRAELYLTMKNYEQALQD-------- 253

  Fly   535 VVRKFIQNDTRLQDGQTLLHIAVNGVMPVDEFYTNEMCRFPCYATALVLVHCGASVVAVDSDRNT 599
             .....||:..|..|..:...|::|:....|....             .::|    :|::.:.| 
Human   254 -ASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKE-------------FLYC----LALNPECN- 299

  Fly   600 PLHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQTAATACKLPILANRL----HAHQN 660
                     :..::.|..|..:| ....|..|.:..::             :.:||    |:|.|
Human   300 ---------SVKKEAQKVMCEVL-FSATANVHENLTSS-------------IQSRLKAQGHSHMN 341

  Fly   661 AHTSLK 666
            |...|:
Human   342 AQALLE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125
ANK repeat 103..129 CDD:293786
Ank_2 105..206 CDD:289560
ANK 142..262 CDD:238125 9/35 (26%)
ANK repeat 142..173 CDD:293786
ANK repeat 178..206 CDD:293786
Ank_2 180..266 CDD:289560 10/39 (26%)
ANK repeat 208..239 CDD:293786 5/12 (42%)
ANK repeat 241..266 CDD:293786 5/24 (21%)
Ank_4 244..294 CDD:290365 14/49 (29%)
ANK 548..685 CDD:238125 19/123 (15%)
ANK repeat 548..594 CDD:293786 6/45 (13%)
ANK repeat 596..636 CDD:293786 6/39 (15%)
LONRF2NP_940863.3 TPR 1 23..58 9/37 (24%)
TPR_16 27..92 CDD:372602 23/77 (30%)
TPR 2 59..91 12/37 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..136 8/34 (24%)
RING1-HC_LONFs 143..174 CDD:319427 5/31 (16%)
TPR 3 197..230 12/65 (18%)
TPR repeat 200..225 CDD:276809 9/41 (22%)
TPR repeat 230..260 CDD:276809 5/44 (11%)
TPR 4 231..264 7/47 (15%)
TPR repeat 265..293 CDD:276809 5/44 (11%)
TPR 5 266..298 6/48 (13%)
PEX10 <380..489 CDD:227861
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..439
RING2-HC_LONFs 446..487 CDD:319428
TPR 6 447..483
RING-HC finger (C3HC4-type) 449..486 CDD:319428
LON_substr_bdg 538..738 CDD:366967
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.