DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fem-1 and LOC110440003

DIOPT Version :9

Sequence 1:NP_611508.1 Gene:Fem-1 / 37344 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_021334017.1 Gene:LOC110440003 / 110440003 -ID:- Length:289 Species:Danio rerio


Alignment Length:192 Identity:63/192 - (32%)
Similarity:106/192 - (55%) Gaps:24/192 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AARSGQMLSFVEILNSVSCRAVQTHLVNTNFDQPDGQSL---------TPLTMAAMMGNVKFVKT 119
            |||.|::            :.:|..|:|.:   |:.::.         |||.:||..|::..|..
Zfish    10 AARDGKL------------KLMQKLLINKS---PEERAALAEERTEGGTPLLIAARYGHLPVVHF 59

  Fly   120 LLSHYDVDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPLRAAC 184
            ||.....:::...:|.:||..:.||..||.|:..|||.:||.|::.||::|:.|...|:||||||
Zfish    60 LLERCGANVELGGSVNFDGETIEGAPPLWAASAAGHLPVVKALLEHGASVNNTTLTNSTPLRAAC 124

  Fly   185 YEGRLDIVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQALCGATAL 246
            ::|.|:||.:|:::.||:...|...:..|||:.||||..:.:.||:.|:..|.:::.|...|
Zfish   125 FDGHLEIVRYLVEHQADLEVANRHGHTCLMISCYKGHREIAQFLLEKGADVNRRSVKGGVLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 46/140 (33%)
ANK repeat 103..129 CDD:293786 9/25 (36%)
Ank_2 105..206 CDD:289560 39/100 (39%)
ANK 142..262 CDD:238125 43/105 (41%)
ANK repeat 142..173 CDD:293786 14/30 (47%)
ANK repeat 178..206 CDD:293786 13/27 (48%)
Ank_2 180..266 CDD:289560 26/67 (39%)
ANK repeat 208..239 CDD:293786 11/30 (37%)
ANK repeat 241..266 CDD:293786 2/6 (33%)
Ank_4 244..294 CDD:290365 1/3 (33%)
ANK 548..685 CDD:238125
ANK repeat 548..594 CDD:293786
ANK repeat 596..636 CDD:293786
LOC110440003XP_021334017.1 Ank_2 <6..68 CDD:330894 17/72 (24%)
ANK 40..169 CDD:238125 49/128 (38%)
ANK repeat 40..75 CDD:293786 9/34 (26%)
ANK repeat 82..113 CDD:293786 14/30 (47%)
ANK repeat 115..146 CDD:293786 14/30 (47%)
ANK repeat 148..178 CDD:293786 11/29 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133963at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.