DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and ISLR2

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001123608.1 Gene:ISLR2 / 57611 HGNCID:29286 Length:745 Species:Homo sapiens


Alignment Length:230 Identity:73/230 - (31%)
Similarity:114/230 - (49%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 LPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGI 406
            ||.  |:.:|:|:.|.|..::..|.|:.:::.||.|.||::..::..|...|..|.:||||:|.|
Human    49 LPA--NVTTLSLSANKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFI 111

  Fly   407 VAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESL 471
            .:...:.|::||.|.:|.:.||.|.:|..|.:..||.||.||:..|.:..:|....|....|..|
Human   112 SSFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHL 176

  Fly   472 QMQENPLSCDCSIRPFAEWLQ--ESQLHSSL----SASCVTPPRLEGAPLLQVPVETLSCDMDNV 530
            |:..||..|.|.:    .|||  .:....||    |.:|.:||.|:|.|:.::|  .|.|...:|
Human   177 QLYHNPFHCGCGL----VWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLP--ALPCAPPSV 235

  Fly   531 EKDNANIMQHLETLAKPNQTSPIKDLSEEI--ILH 563
                     ||.  |:|...:|...|...:  :||
Human   236 ---------HLS--AEPPLEAPGTPLRAGLAFVLH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 47/136 (35%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
LRR_8 322..382 CDD:290566 14/39 (36%)
leucine-rich repeat 323..347 CDD:275380 2/4 (50%)
leucine-rich repeat 348..371 CDD:275380 6/22 (27%)
LRR_8 370..428 CDD:290566 19/57 (33%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 418..478 CDD:290566 21/59 (36%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRRCT 476..526 CDD:214507 18/55 (33%)
ISLR2NP_001123608.1 leucine-rich repeat 36..52 CDD:275380 2/4 (50%)
LRR_8 52..109 CDD:404697 19/56 (34%)
LRR 1 52..73 6/20 (30%)
leucine-rich repeat 53..76 CDD:275380 6/22 (27%)
LRR 2 76..97 6/20 (30%)
leucine-rich repeat 77..100 CDD:275380 7/22 (32%)
LRR_8 99..159 CDD:404697 24/59 (41%)
LRR 3 100..123 8/22 (36%)
leucine-rich repeat 101..124 CDD:275380 9/22 (41%)
LRR 4 124..145 7/20 (35%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR 5 148..169 6/20 (30%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
PCC 154..>228 CDD:188093 23/79 (29%)
Ig_3 232..359 CDD:404760 9/39 (23%)
Ig strand B 256..263 CDD:409353 2/4 (50%)
Ig strand C 269..274 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..326
Ig strand C' 305..307 CDD:409353
Ig strand D 331..335 CDD:409353
Ig strand E 338..343 CDD:409353
Ig strand F 351..359 CDD:409353
Ig strand G 362..372 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 656..722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.