DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and si:ch211-237i5.4

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_001920877.1 Gene:si:ch211-237i5.4 / 557635 ZFINID:ZDB-GENE-131121-468 Length:346 Species:Danio rerio


Alignment Length:277 Identity:88/277 - (31%)
Similarity:124/277 - (44%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 LDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRL----GDYAQ 312
            |||..|::..:.:..|.||.||..|.||::.|.::..:.|.:|..||.|.:..|.|    .::::
Zfish    55 LDLGGNRLTEIRSRAFAGLWSLRILVLSDSNIQALQSQAFFSLSFLEKLDMSHNNLTQIPPNFSE 119

  Fly   313 SLRSLSQCLSLRQLDLQANNLNGPLSEQTL--PGMRNLESLNLNRNLIKSIQNKALANFSRLVSL 375
            ||.      |||:|.|..|.|      |.|  ||:.:||:                     |..|
Zfish   120 SLS------SLRELRLDHNAL------QLLKPPGLEHLEN---------------------LAKL 151

  Fly   376 SLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIAP 440
            .|.||.|..|:..||.||..|..|.|..|.:..|...||..|..|.||.|.:|.:..:..:.:||
Zfish   152 DLSHNHIQSLEPGAFRGLSRLRHLYLQGNHLDVIRDRSLTMLPALEVLQLGNNNISQIEVNALAP 216

  Fly   441 LPSLRELRLAGNDISIVARNAMDGARELES-LQMQENPLSCDCSI-RPFAEWLQESQLH--SSLS 501
            |.||..|.|.||.:..:........|...: |.:..||.||||.: |.|::.|....||  ...:
Zfish   217 LHSLSLLGLEGNQLEHLNFKTFLSLRTATTHLLLSGNPWSCDCDLHRVFSKLLSVRHLHVDDYHN 281

  Fly   502 ASCVTPPRLEGAPLLQV 518
            .:|..|.:|.||.|..|
Zfish   282 VTCREPWQLAGASLAWV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 28/85 (33%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566 19/54 (35%)
leucine-rich repeat 249..272 CDD:275380 7/19 (37%)
LRR_RI <270..479 CDD:238064 66/215 (31%)
leucine-rich repeat 273..296 CDD:275380 7/22 (32%)
leucine-rich repeat 297..322 CDD:275380 7/28 (25%)
LRR_8 322..382 CDD:290566 18/61 (30%)
leucine-rich repeat 323..347 CDD:275380 10/25 (40%)
leucine-rich repeat 348..371 CDD:275380 2/22 (9%)
LRR_8 370..428 CDD:290566 23/57 (40%)
leucine-rich repeat 372..395 CDD:275380 11/22 (50%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 418..478 CDD:290566 17/60 (28%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 5/22 (23%)
LRRCT 476..526 CDD:214507 18/46 (39%)
si:ch211-237i5.4XP_001920877.1 leucine-rich repeat 34..53 CDD:275380
leucine-rich repeat 54..75 CDD:275380 7/19 (37%)
LRR_RI <69..238 CDD:238064 64/201 (32%)
LRR_8 75..134 CDD:290566 21/64 (33%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 7/28 (25%)
LRR_8 122..182 CDD:290566 28/92 (30%)
leucine-rich repeat 124..147 CDD:275380 11/28 (39%)
leucine-rich repeat 148..171 CDD:275380 11/22 (50%)
LRR_8 170..230 CDD:290566 22/59 (37%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..240 CDD:275380 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.