Sequence 1: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001178867.1 | Gene: | Lrit2 / 498594 | RGDID: | 1564668 | Length: | 549 | Species: | Rattus norvegicus |
Alignment Length: | 447 | Identity: | 95/447 - (21%) |
---|---|---|---|
Similarity: | 162/447 - (36%) | Gaps: | 147/447 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 YAQSLRSLSQCL---------SLRQLDLQANNLNGPLSEQTLP-----GMRNLESLNLNRNLIKS 360
Fly 361 IQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDL 425
Fly 426 THNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAEW 490
Fly 491 LQE----------------------SQLHSSLSASCVTPPRLEGAPLLQVPVE-----TLSC--- 525
Fly 526 --DMDNVE-KDNANIMQHLETLAKPNQTSPIKDLSEEII-------------------------- 561
Fly 562 ------------LHELHFSTD--------------YGLILTWL--LNLSKKDYMCDAIFVYKEEH 598
Fly 599 INEILIDNSPIHCESKVVN---GQNTVSV--IVPDSSSLEIGESYRFCLVMIQEQKP 650 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | 6/32 (19%) |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | |||
leucine-rich repeat | 225..248 | CDD:275380 | |||
LRR_8 | 249..307 | CDD:290566 | |||
leucine-rich repeat | 249..272 | CDD:275380 | |||
LRR_RI | <270..479 | CDD:238064 | 48/182 (26%) | ||
leucine-rich repeat | 273..296 | CDD:275380 | |||
leucine-rich repeat | 297..322 | CDD:275380 | 4/20 (20%) | ||
LRR_8 | 322..382 | CDD:290566 | 20/64 (31%) | ||
leucine-rich repeat | 323..347 | CDD:275380 | 7/28 (25%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 370..428 | CDD:290566 | 20/57 (35%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 418..478 | CDD:290566 | 11/59 (19%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 2/22 (9%) | ||
LRRCT | 476..526 | CDD:214507 | 15/81 (19%) | ||
Lrit2 | NP_001178867.1 | LRR_8 | 56..115 | CDD:290566 | 20/64 (31%) |
leucine-rich repeat | 57..80 | CDD:275378 | 7/28 (25%) | ||
LRR_4 | 81..119 | CDD:289563 | 13/37 (35%) | ||
leucine-rich repeat | 81..104 | CDD:275378 | 9/22 (41%) | ||
LRR_8 | 103..163 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 105..128 | CDD:275378 | 6/22 (27%) | ||
LRR_4 | 129..164 | CDD:289563 | 15/34 (44%) | ||
leucine-rich repeat | 129..152 | CDD:275378 | 10/22 (45%) | ||
leucine-rich repeat | 153..164 | CDD:275378 | 5/10 (50%) | ||
leucine-rich repeat | 177..204 | CDD:275378 | 5/35 (14%) | ||
TPKR_C2 | 200..243 | CDD:301599 | 6/42 (14%) | ||
I-set | 253..344 | CDD:254352 | 15/94 (16%) | ||
Ig | 270..341 | CDD:143165 | 12/72 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |