Sequence 1: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_982350.1 | Gene: | rtn4rl2b / 403309 | ZFINID: | ZDB-GENE-040310-2 | Length: | 457 | Species: | Danio rerio |
Alignment Length: | 302 | Identity: | 86/302 - (28%) |
---|---|---|---|
Similarity: | 126/302 - (41%) | Gaps: | 84/302 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 238 VPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKL 302
Fly 303 GGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKS------- 360
Fly 361 ---------IQNKALAN-----FSRLVSLS---LRHNQIDVLQDHAFFGLGALDSLDLSYNGIVA 408
Fly 409 ISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQM 473
Fly 474 QENPLSCDCSIRPFAEWLQESQLHSSLSASCVTPPRLEGAPL 515 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | 32/95 (34%) |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | |||
leucine-rich repeat | 225..248 | CDD:275380 | 2/9 (22%) | ||
LRR_8 | 249..307 | CDD:290566 | 24/57 (42%) | ||
leucine-rich repeat | 249..272 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | <270..479 | CDD:238064 | 64/232 (28%) | ||
leucine-rich repeat | 273..296 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 297..322 | CDD:275380 | 5/24 (21%) | ||
LRR_8 | 322..382 | CDD:290566 | 21/83 (25%) | ||
leucine-rich repeat | 323..347 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 8/43 (19%) | ||
LRR_8 | 370..428 | CDD:290566 | 24/60 (40%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 10/25 (40%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 418..478 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 4/22 (18%) | ||
LRRCT | 476..526 | CDD:214507 | 13/40 (33%) | ||
rtn4rl2b | NP_982350.1 | LRRNT | 40..71 | CDD:214470 | 2/2 (100%) |
leucine-rich repeat | 53..70 | CDD:275380 | 1/1 (100%) | ||
leucine-rich repeat | 73..93 | CDD:275380 | 9/20 (45%) | ||
LRR_RI | 93..>326 | CDD:238064 | 75/269 (28%) | ||
LRR_8 | 95..153 | CDD:290566 | 26/84 (31%) | ||
leucine-rich repeat | 95..117 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 118..142 | CDD:275380 | 12/49 (24%) | ||
leucine-rich repeat | 143..166 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 166..225 | CDD:290566 | 20/58 (34%) | ||
LRR_4 | 166..206 | CDD:289563 | 11/39 (28%) | ||
leucine-rich repeat | 167..190 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 191..214 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 214..272 | CDD:290566 | 21/81 (26%) | ||
leucine-rich repeat | 215..238 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 239..262 | CDD:275380 | 7/22 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4913 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |