DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and rtn4rl2a

DIOPT Version :10

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_982346.1 Gene:rtn4rl2a / 403307 ZFINID:ZDB-GENE-040310-4 Length:458 Species:Danio rerio


Alignment Length:271 Identity:82/271 - (30%)
Similarity:118/271 - (43%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 ERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGN----RL-GD 309
            :|:.|.||:|..|....|...|.:::| .||| |:.|....|..||.||.|.||.|    || |.
Zfish    73 QRVFLQNNRITELRVGSFAFGTQVLWL-FSNN-ITWIEAGAFSELRDLEELDLGDNPNLHRLEGG 135

  Fly   310 YAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVS 374
            ..:.|..| |.|.:.:..|.|      |.......:.:|:.|.|..|.:..||:...|:...|..
Zfish   136 AFRGLEKL-QSLHMHRCKLAA------LPHDIFHKLYSLQFLYLQENQLHFIQDDLFADLINLSQ 193

  Fly   375 LSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIA 439
            |.|..|:|..|.::.|.||..||.|.|..|.:..::..:.:.|.:||:|.|.:|.|        |
Zfish   194 LFLHGNRIRTLSENVFRGLVNLDRLLLHDNRVRQVNRRAFRDLGQLTMLFLFNNSL--------A 250

  Fly   440 PLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAEWLQESQLHSSLSASC 504
            .||.                .||.....:|.|::..||.:|.|..||..|:.:.::|.|| ...|
Zfish   251 ELPG----------------QAMRDVSSIEFLRLNNNPWACGCEARPLWEFFRGARLSSS-EVLC 298

  Fly   505 VTPPRLEGAPL 515
            .:|....|..|
Zfish   299 ASPASRRGQDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR 175..582 CDD:443914 82/271 (30%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
leucine-rich repeat 249..272 CDD:275380 7/21 (33%)
leucine-rich repeat 273..296 CDD:275380 8/22 (36%)
leucine-rich repeat 297..322 CDD:275380 12/29 (41%)
leucine-rich repeat 323..347 CDD:275380 3/23 (13%)
leucine-rich repeat 348..371 CDD:275380 7/22 (32%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 6/22 (27%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 2/22 (9%)
rtn4rl2aNP_982346.1 leucine-rich repeat 53..70 CDD:275380
LRR <73..>254 CDD:443914 63/197 (32%)
leucine-rich repeat 73..93 CDD:275380 7/19 (37%)
leucine-rich repeat 95..117 CDD:275380 8/23 (35%)
leucine-rich repeat 118..142 CDD:275380 10/23 (43%)
leucine-rich repeat 143..166 CDD:275380 6/29 (21%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..262 CDD:275380 11/46 (24%)
LRRCT 271..316 CDD:214507 14/40 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.