DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and rtn4rl2a

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_982346.1 Gene:rtn4rl2a / 403307 ZFINID:ZDB-GENE-040310-4 Length:458 Species:Danio rerio


Alignment Length:271 Identity:82/271 - (30%)
Similarity:118/271 - (43%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 ERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGN----RL-GD 309
            :|:.|.||:|..|....|...|.:::| .||| |:.|....|..||.||.|.||.|    || |.
Zfish    73 QRVFLQNNRITELRVGSFAFGTQVLWL-FSNN-ITWIEAGAFSELRDLEELDLGDNPNLHRLEGG 135

  Fly   310 YAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVS 374
            ..:.|..| |.|.:.:..|.|      |.......:.:|:.|.|..|.:..||:...|:...|..
Zfish   136 AFRGLEKL-QSLHMHRCKLAA------LPHDIFHKLYSLQFLYLQENQLHFIQDDLFADLINLSQ 193

  Fly   375 LSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIA 439
            |.|..|:|..|.::.|.||..||.|.|..|.:..::..:.:.|.:||:|.|.:|.|        |
Zfish   194 LFLHGNRIRTLSENVFRGLVNLDRLLLHDNRVRQVNRRAFRDLGQLTMLFLFNNSL--------A 250

  Fly   440 PLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAEWLQESQLHSSLSASC 504
            .||.                .||.....:|.|::..||.:|.|..||..|:.:.::|.|| ...|
Zfish   251 ELPG----------------QAMRDVSSIEFLRLNNNPWACGCEARPLWEFFRGARLSSS-EVLC 298

  Fly   505 VTPPRLEGAPL 515
            .:|....|..|
Zfish   299 ASPASRRGQDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 32/88 (36%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566 23/60 (38%)
leucine-rich repeat 249..272 CDD:275380 7/21 (33%)
LRR_RI <270..479 CDD:238064 63/213 (30%)
leucine-rich repeat 273..296 CDD:275380 8/22 (36%)
leucine-rich repeat 297..322 CDD:275380 12/29 (41%)
LRR_8 322..382 CDD:290566 14/59 (24%)
leucine-rich repeat 323..347 CDD:275380 3/23 (13%)
leucine-rich repeat 348..371 CDD:275380 7/22 (32%)
LRR_8 370..428 CDD:290566 19/57 (33%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 6/22 (27%)
LRR_8 418..478 CDD:290566 14/59 (24%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 2/22 (9%)
LRRCT 476..526 CDD:214507 14/40 (35%)
rtn4rl2aNP_982346.1 leucine-rich repeat 53..70 CDD:275380
LRR_8 73..127 CDD:290566 22/55 (40%)
leucine-rich repeat 73..93 CDD:275380 7/19 (37%)
LRR_RI 94..>329 CDD:238064 75/250 (30%)
leucine-rich repeat 95..117 CDD:275380 8/23 (35%)
leucine-rich repeat 118..142 CDD:275380 10/23 (43%)
leucine-rich repeat 143..166 CDD:275380 6/29 (21%)
LRR_8 166..225 CDD:290566 21/58 (36%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
LRR_8 214..272 CDD:290566 19/81 (23%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..262 CDD:275380 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.