Sequence 1: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_982346.1 | Gene: | rtn4rl2a / 403307 | ZFINID: | ZDB-GENE-040310-4 | Length: | 458 | Species: | Danio rerio |
Alignment Length: | 271 | Identity: | 82/271 - (30%) |
---|---|---|---|
Similarity: | 118/271 - (43%) | Gaps: | 39/271 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 ERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGN----RL-GD 309
Fly 310 YAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVS 374
Fly 375 LSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIA 439
Fly 440 PLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAEWLQESQLHSSLSASC 504
Fly 505 VTPPRLEGAPL 515 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | 32/88 (36%) |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | |||
leucine-rich repeat | 225..248 | CDD:275380 | |||
LRR_8 | 249..307 | CDD:290566 | 23/60 (38%) | ||
leucine-rich repeat | 249..272 | CDD:275380 | 7/21 (33%) | ||
LRR_RI | <270..479 | CDD:238064 | 63/213 (30%) | ||
leucine-rich repeat | 273..296 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 297..322 | CDD:275380 | 12/29 (41%) | ||
LRR_8 | 322..382 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 323..347 | CDD:275380 | 3/23 (13%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 370..428 | CDD:290566 | 19/57 (33%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 418..478 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 2/22 (9%) | ||
LRRCT | 476..526 | CDD:214507 | 14/40 (35%) | ||
rtn4rl2a | NP_982346.1 | leucine-rich repeat | 53..70 | CDD:275380 | |
LRR_8 | 73..127 | CDD:290566 | 22/55 (40%) | ||
leucine-rich repeat | 73..93 | CDD:275380 | 7/19 (37%) | ||
LRR_RI | 94..>329 | CDD:238064 | 75/250 (30%) | ||
leucine-rich repeat | 95..117 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 118..142 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 143..166 | CDD:275380 | 6/29 (21%) | ||
LRR_8 | 166..225 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 167..190 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 191..214 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 214..272 | CDD:290566 | 19/81 (23%) | ||
leucine-rich repeat | 215..238 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 239..262 | CDD:275380 | 11/46 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |