DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Flrt1

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_958813.1 Gene:Flrt1 / 396184 MGIID:3026647 Length:674 Species:Mus musculus


Alignment Length:611 Identity:134/611 - (21%)
Similarity:227/611 - (37%) Gaps:159/611 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 GLTSL--------VYLELSNNQISS--ISQ--RTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCL 321
            ||||:        ..|.|.||||::  |.|  :|.|   |::|:.|..|.|.::..:|..     
Mouse    71 GLTSIPSDIPDDATTLYLQNNQINNAGIPQDLKTKV---KVQVIYLYENDLDEFPINLPR----- 127

  Fly   322 SLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIK--SIQNKALANFS--RLVSLSLRH--- 379
            |||:|.||.||:. .::..:|..:..||.|:|:.|.:.  ||:..|.|:..  :|:.||..|   
Mouse   128 SLRELHLQDNNVR-TIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSS 191

  Fly   380 ----------------NQIDVLQDHAFFGLGALDSLDLSYNGIV--AISSASLQHLSRLTVLDLT 426
                            |:|..:..|||.||.:|..|.|..|.:.  .|:..:...|..||.|.|.
Mouse   192 IPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLV 256

  Fly   427 HNFLRA--------------LTSDLIAPLP-----SLRELR---LAGNDISIVARNAMDGARELE 469
            .|.|.|              |..:.|:.:|     .:|||.   |:.|:::.:.|...|....|.
Mouse   257 RNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLA 321

  Fly   470 SLQMQENPLSCDCSIRPFAEWLQ-ESQLHSSLSASCVTPPRLEGAPLLQVPVETLSCDMDNVEKD 533
            .|.::.||..|.|::....:|:: .:.:.:.....|..|.::.|..:..:..|...|.....:..
Mouse   322 QLLLRNNPWFCGCNLMWLRDWVRARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFEAGSQGG 386

  Fly   534 NAN------IMQHLETLAKPNQTSPIK--------------------DLSEEIILHELHFSTDYG 572
            .||      :..|............:|                    |.::.:::.....:.| .
Mouse   387 AANAAAKTTVSNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLVIQVKPLTAD-S 450

  Fly   573 LILTWLLNLSKKDYMCDAIFVYKEEH------INEILID--------------NSPIHCESKVVN 617
            :.:||...|....:....:   :..|      |.|.|:.              ::.|.|...:..
Mouse   451 IRITWKAMLPASSFRLSWL---RLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMET 512

  Fly   618 GQNTVSVIVPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSNITRLERSSPGAVPV-------- 674
            |...|:...|..:..|..:||.....:.|||.......:..:.|.      .|||.:        
Mouse   513 GNTYVADETPVCAKAETADSYGPTTTLNQEQNAGPMAGLPLAGII------GGAVALVFLFLVLG 571

  Fly   675 -SRQYQRRPYYNANE-LKPEVVHDAG----EDY-QVNQRRFNSVV-----GSQ-----PQQTQQS 722
             ...|..|    |.| |..|.|::.|    :|| :...::.||::     |.|     |.::::.
Mouse   572 AICWYVHR----AGELLTRERVYNRGSRRKDDYMESGTKKDNSILEIRGPGLQMLPINPYRSKEE 632

  Fly   723 TLLHSYTVIDSLNKSFLPG---LGLG 745
            .::|  |:..|...|...|   :|.|
Mouse   633 YVVH--TIFPSNGSSLCKGAHTIGYG 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 28/76 (37%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566 18/49 (37%)
leucine-rich repeat 249..272 CDD:275380 2/2 (100%)
LRR_RI <270..479 CDD:238064 75/267 (28%)
leucine-rich repeat 273..296 CDD:275380 10/34 (29%)
leucine-rich repeat 297..322 CDD:275380 5/24 (21%)
LRR_8 322..382 CDD:290566 23/82 (28%)
leucine-rich repeat 323..347 CDD:275380 8/23 (35%)
leucine-rich repeat 348..371 CDD:275380 9/26 (35%)
LRR_8 370..428 CDD:290566 21/80 (26%)
leucine-rich repeat 372..395 CDD:275380 11/41 (27%)
leucine-rich repeat 396..419 CDD:275380 6/24 (25%)
LRR_8 418..478 CDD:290566 20/81 (25%)
leucine-rich repeat 420..443 CDD:275380 10/41 (24%)
leucine-rich repeat 444..467 CDD:275380 7/25 (28%)
LRRCT 476..526 CDD:214507 9/50 (18%)
Flrt1NP_958813.1 PRK15370 <58..>329 CDD:185268 74/266 (28%)
leucine-rich repeat 108..128 CDD:275380 5/24 (21%)
leucine-rich repeat 129..152 CDD:275380 8/23 (35%)
leucine-rich repeat 153..178 CDD:275380 9/24 (38%)
leucine-rich repeat 179..199 CDD:275380 4/19 (21%)
leucine-rich repeat 200..223 CDD:275380 7/22 (32%)
leucine-rich repeat 224..249 CDD:275380 6/24 (25%)
leucine-rich repeat 250..271 CDD:275380 7/20 (35%)
leucine-rich repeat 272..295 CDD:275380 3/22 (14%)
leucine-rich repeat 296..319 CDD:275380 5/22 (23%)
PCC 300..>406 CDD:188093 19/105 (18%)
FN3 441..505 CDD:214495 8/67 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.