DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and LRRC26

DIOPT Version :10

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001013675.1 Gene:LRRC26 / 389816 HGNCID:31409 Length:334 Species:Homo sapiens


Alignment Length:176 Identity:60/176 - (34%)
Similarity:91/176 - (51%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 PGMR-NLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGI 406
            ||:. .|.:|.|:.|.::::...|.|....|..|.||.|.:..:...||:|||||..||||.|.:
Human    67 PGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQL 131

  Fly   407 VAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESL 471
            .|::..:...|..|..|.|..|.|..|....:..||.||.|.|..|:::.:|...:.....|::|
Human   132 EALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDAL 196

  Fly   472 QMQENPLSCDCSIRPFAEWLQESQLHSSLSAS--CVTPPRLEGAPL 515
            .::.||..|.|::||...||:...|.:|.:.:  ||.|.||..:||
Human   197 HLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR 175..582 CDD:443914 60/176 (34%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
leucine-rich repeat 249..272 CDD:275380
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
leucine-rich repeat 323..347 CDD:275380 2/4 (50%)
leucine-rich repeat 348..371 CDD:275380 6/22 (27%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRRC26NP_001013675.1 LRR 1 72..93 5/20 (25%)
LRR <79..>201 CDD:443914 38/121 (31%)
LRR 2 96..117 7/20 (35%)
leucine-rich repeat 97..120 CDD:275380 9/22 (41%)
LRR 3 120..141 8/20 (40%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
LRR 4 144..167 6/22 (27%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR 5 168..190 6/21 (29%)
leucine-rich repeat 169..192 CDD:275380 6/22 (27%)
PCC 174..>242 CDD:188093 20/67 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..334
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.