DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Lapsyn

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster


Alignment Length:329 Identity:88/329 - (26%)
Similarity:131/329 - (39%) Gaps:102/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LH--GLVISSGEIKRV---HKSAFLGIRGPLQALGLPGNALMSVPWNALSTLSALERLDLANNKI 259
            ||  |.:|.| |:::.   |....|.||    ...|.   |..||.|   ..|::|.|||::|:|
  Fly    17 LHSAGFIIQS-EVRKCTYGHIDKLLRIR----CYDLD---LKEVPQN---LKSSVEVLDLSHNRI 70

  Fly   260 KALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCLSLR 324
            :.|.|:.|...|.:.:|.|.:|.|.|:...||..|                          .||:
  Fly    71 RKLKTSSFQRYTDIKFLMLYDNMILSVEVGTFEPL--------------------------TSLQ 109

  Fly   325 QLDLQANNLNG-PLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSR--LVSLSLRHNQIDVLQ 386
            ::||..|.|.. ||....||.:||   |.::.|.:.|:..:||....|  |..|::...::..|.
  Fly   110 EIDLSNNGLTTIPLELFQLPRLRN---LYIDSNELTSLNLQALEKPIRAPLEYLNVAGCELQELP 171

  Fly   387 DHAFFGLGALD---SLDLSYNGIVAISSASLQHLSRLTVLDLTHNFL-----RALTSDLIAPLPS 443
            |     ||.|.   .|:.|.|.:......||.::..|.|:|||.:.|     :.:|:.|:     
  Fly   172 D-----LGILPKLWQLNASMNPLQNFRIDSLANMCHLQVIDLTKSQLSQCGCQQVTNHLM----- 226

  Fly   444 LRELRLAGNDISIVARNAMDGARE------LESLQMQENPLSCDCSIRPFAEWLQESQLHSSLSA 502
                              |.||..      ||:|.::|.||       |:     ...:||...|
  Fly   227 ------------------MLGASPKFVPVCLEALDIRECPL-------PY-----NRTIHSPTFA 261

  Fly   503 SCVT 506
            ||.|
  Fly   262 SCQT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 39/138 (28%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380 9/27 (33%)
leucine-rich repeat 225..248 CDD:275380 5/22 (23%)
LRR_8 249..307 CDD:290566 18/57 (32%)
leucine-rich repeat 249..272 CDD:275380 9/22 (41%)
LRR_RI <270..479 CDD:238064 55/225 (24%)
leucine-rich repeat 273..296 CDD:275380 8/22 (36%)
leucine-rich repeat 297..322 CDD:275380 0/24 (0%)
LRR_8 322..382 CDD:290566 20/62 (32%)
leucine-rich repeat 323..347 CDD:275380 9/24 (38%)
leucine-rich repeat 348..371 CDD:275380 5/22 (23%)
LRR_8 370..428 CDD:290566 18/62 (29%)
leucine-rich repeat 372..395 CDD:275380 5/22 (23%)
leucine-rich repeat 396..419 CDD:275380 6/25 (24%)
LRR_8 418..478 CDD:290566 15/70 (21%)
leucine-rich repeat 420..443 CDD:275380 8/27 (30%)
leucine-rich repeat 444..467 CDD:275380 3/22 (14%)
LRRCT 476..526 CDD:214507 9/31 (29%)
LapsynNP_611561.1 leucine-rich repeat 39..59 CDD:275380 8/29 (28%)
LRR_8 58..118 CDD:290566 24/85 (28%)
leucine-rich repeat 60..83 CDD:275380 9/22 (41%)
leucine-rich repeat 84..107 CDD:275380 8/48 (17%)
LRR_RI <94..>249 CDD:238064 50/211 (24%)
LRR_8 106..167 CDD:290566 20/63 (32%)
LRR_4 106..145 CDD:289563 15/41 (37%)
leucine-rich repeat 108..130 CDD:275380 8/21 (38%)
leucine-rich repeat 131..154 CDD:275380 7/25 (28%)
leucine-rich repeat 157..178 CDD:275380 7/25 (28%)
leucine-rich repeat 179..202 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.