DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and 18w

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster


Alignment Length:587 Identity:143/587 - (24%)
Similarity:235/587 - (40%) Gaps:99/587 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VNKSSPRKRKAEQVS-SLPLPVDDALMEWKCPNITGTRNAELECGCDLP------HTLRCNIDLH 160
            :|.:..|.|.||.:. |..|....||         ...|..:..|.:|.      :.||...|..
  Fly   174 LNLTQNRIRSAEFLGFSEKLCAGSAL---------SNANGAVSGGSELQTLDVSFNELRSLPDAW 229

  Fly   161 GMMLLADRLRTSPYSISLLDCSLRNVTFLSDAKIFDNVSLHGLVISSGEIKRVHKSAFLGIRGPL 225
            |    |.|||    .:..|.....|::.|:...:....||..|.||...:..:...||.|.: .|
  Fly   230 G----ASRLR----RLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNK-EL 285

  Fly   226 QALGLPGNALMSVPWNALSTLSALERLDLANNKIKA--LGTADFVGLTSLVYLELSNNQISSISQ 288
            :.|.|.||.|..:|...|..|..|..|||:.|::.:  :..:.|.||..|:.|.||||.::.|..
  Fly   286 RELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGS 350

  Fly   289 RTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNL 353
            :||..|..|::|.:..|.:|...:.  :.....:|..|:|..|.|: .|..:...|:..|..|.|
  Fly   351 KTFKELYFLQILDMRNNSIGHIEEG--AFLPLYNLHTLNLAENRLH-TLDNRIFNGLYVLTKLTL 412

  Fly   354 NRNLIKSIQNKALANFSRLVSLSLRHNQI----DVLQDHAFFGLGALDSLDLSYNGIVAISSASL 414
            |.||:..::::|..|.|.|..|.|..||:    :.:||     |..|.:|||..|.|....:.:.
  Fly   413 NNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQD-----LSMLKTLDLGENQISEFKNNTF 472

  Fly   415 QHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLS 479
            ::|::||.|.|..|.:..:|..:...||.|..|.||.|.|..:.|.|.|...|:|::::.:|.|:
  Fly   473 RNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLT 537

  Fly   480 CDCSIRPFAE-----WLQESQLHSSLSASCVTPPRLEGAPL-------------LQVPVETLSCD 526
            ....|  ||.     ||..|:.|.........|..|:...:             ||..:...:.|
  Fly   538 DINGI--FATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLD 600

  Fly   527 MDNVEKDNANIMQHLETLAKPNQTSPIKDLSEEIILHELHFSTDYGLILTWLLNLSKKDYMCDAI 591
            ..:      |.:..:..::.||....:  .....|:.::..:|     ......|::.|...:.:
  Fly   601 ASH------NRITEIGAMSVPNSIELL--FINNNIIGQIQANT-----FVDKTRLARVDLYANVL 652

  Fly   592 F-----------VYKEEHINEILIDNSPIHCESKV-----VNGQNT-----------VSVIVPDS 629
            .           |..|:.:.|..:..:|..|:..:     :|...|           :..::|.|
  Fly   653 SKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHS 717

  Fly   630 SS 631
            .|
  Fly   718 RS 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 54/184 (29%)
leucine-rich repeat 179..199 CDD:275378 3/19 (16%)
leucine-rich repeat 200..223 CDD:275380 7/22 (32%)
leucine-rich repeat 225..248 CDD:275380 9/22 (41%)
LRR_8 249..307 CDD:290566 21/59 (36%)
leucine-rich repeat 249..272 CDD:275380 8/24 (33%)
LRR_RI <270..479 CDD:238064 66/212 (31%)
leucine-rich repeat 273..296 CDD:275380 10/22 (45%)
leucine-rich repeat 297..322 CDD:275380 4/24 (17%)
LRR_8 322..382 CDD:290566 20/59 (34%)
leucine-rich repeat 323..347 CDD:275380 7/23 (30%)
leucine-rich repeat 348..371 CDD:275380 8/22 (36%)
LRR_8 370..428 CDD:290566 20/61 (33%)
leucine-rich repeat 372..395 CDD:275380 8/26 (31%)
leucine-rich repeat 396..419 CDD:275380 7/22 (32%)
LRR_8 418..478 CDD:290566 20/59 (34%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..467 CDD:275380 9/22 (41%)
LRRCT 476..526 CDD:214507 13/67 (19%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 1/6 (17%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380 9/35 (26%)
LRR_RI 210..464 CDD:238064 80/270 (30%)
leucine-rich repeat 212..236 CDD:275380 9/31 (29%)
LRR_8 235..295 CDD:290566 17/64 (27%)
leucine-rich repeat 237..260 CDD:275380 3/22 (14%)
leucine-rich repeat 261..284 CDD:275380 7/23 (30%)
LRR_8 283..345 CDD:290566 23/62 (37%)
leucine-rich repeat 285..308 CDD:275380 9/22 (41%)
leucine-rich repeat 309..334 CDD:275380 8/24 (33%)
LRR_8 334..393 CDD:290566 18/60 (30%)
leucine-rich repeat 335..358 CDD:275380 10/22 (45%)
leucine-rich repeat 359..382 CDD:275380 4/24 (17%)
LRR_8 382..441 CDD:290566 20/59 (34%)
leucine-rich repeat 383..406 CDD:275380 7/23 (30%)
leucine-rich repeat 407..430 CDD:275380 8/22 (36%)
LRR_8 431..488 CDD:290566 20/61 (33%)
leucine-rich repeat 431..451 CDD:275380 7/24 (29%)
leucine-rich repeat 454..477 CDD:275380 7/22 (32%)
LRR_8 477..559 CDD:290566 27/83 (33%)
leucine-rich repeat 478..499 CDD:275380 6/20 (30%)
leucine-rich repeat 502..525 CDD:275380 9/22 (41%)
leucine-rich repeat 526..548 CDD:275380 6/23 (26%)
leucine-rich repeat 590..617 CDD:275380 5/32 (16%)
leucine-rich repeat 618..641 CDD:275380 2/29 (7%)
leucine-rich repeat 642..689 CDD:275380 7/46 (15%)
LRRCT 679..736 CDD:214507 7/41 (17%)
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.