DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Lrg1

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_038939951.1 Gene:Lrg1 / 367455 RGDID:1359464 Length:342 Species:Rattus norvegicus


Alignment Length:385 Identity:96/385 - (24%)
Similarity:149/385 - (38%) Gaps:105/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 PYSISLLDCSLRNVTFLSDAKIFDNVSLHGLVISSGEIKRVHKSAFLGIRGPLQ-ALGLPGNAL- 235
            |.::.|| ..|..|:.|.:..|..:|                |.:.:...||.: ...||.:.: 
  Rat    18 PRTLFLL-ALLGGVSGLRECLILQSV----------------KGSTVSCHGPTEFPSSLPADTVH 65

  Fly   236 MSVPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVL 300
            :||.:::|:.|.|                |...|...|..|.||:|::..:|......:.:|.||
  Rat    66 LSVEFSSLTQLPA----------------AALQGCPGLQELHLSSNRLQELSPGLLAPVPRLRVL 114

  Fly   301 KLGGNRLGDYAQSLRSLSQCL-----SLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKS 360
            .|..|       :||||...|     :|..|.|:.|.|. ..|.:.|.|:..|..|:|..|.::|
  Rat   115 DLTRN-------ALRSLPPGLFRSSAALNTLVLRENQLQ-EASARWLQGLDALGYLDLAENRLRS 171

  Fly   361 IQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDL 425
            :..:.|||                        ||||.:|||.:|.:.::....|:...||..|.|
  Rat   172 LPARLLAN------------------------LGALHTLDLGHNLLESLPEGFLRGPRRLQRLHL 212

  Fly   426 THNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLS----------- 479
            ..|.|:.|.:.|:||.|.|..|.|..|.::.||.::..|.::|:.|.:..|.||           
  Rat   213 EGNRLQRLEAGLLAPQPFLGVLFLNDNQLTAVAADSFRGLKQLDMLDLSNNSLSSTPPGLWAFLG 277

  Fly   480 ------------------CDCSIRPFAEWLQESQLHSSLSAS---CVTPPRLEGAPLLQV 518
                              ||..:.....||..:: |...|.:   |..|..:.|..||.|
  Rat   278 RPTRDMQDGFDVSHNPWVCDKDLVDLCRWLAANR-HKMFSQNDTLCAGPEAVRGQRLLDV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 40/167 (24%)
leucine-rich repeat 179..199 CDD:275378 5/19 (26%)
leucine-rich repeat 200..223 CDD:275380 1/22 (5%)
leucine-rich repeat 225..248 CDD:275380 6/24 (25%)
LRR_8 249..307 CDD:290566 13/57 (23%)
leucine-rich repeat 249..272 CDD:275380 2/22 (9%)
LRR_RI <270..479 CDD:238064 62/213 (29%)
leucine-rich repeat 273..296 CDD:275380 6/22 (27%)
leucine-rich repeat 297..322 CDD:275380 10/29 (34%)
LRR_8 322..382 CDD:290566 16/59 (27%)
leucine-rich repeat 323..347 CDD:275380 8/23 (35%)
leucine-rich repeat 348..371 CDD:275380 8/22 (36%)
LRR_8 370..428 CDD:290566 13/57 (23%)
leucine-rich repeat 372..395 CDD:275380 1/22 (5%)
leucine-rich repeat 396..419 CDD:275380 6/22 (27%)
LRR_8 418..478 CDD:290566 21/59 (36%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRRCT 476..526 CDD:214507 15/75 (20%)
Lrg1XP_038939951.1 PRK15370 <55..>293 CDD:185268 73/285 (26%)
leucine-rich repeat 65..86 CDD:275380 7/36 (19%)
leucine-rich repeat 87..110 CDD:275380 6/22 (27%)
leucine-rich repeat 111..134 CDD:275380 10/29 (34%)
leucine-rich repeat 135..158 CDD:275380 8/23 (35%)
leucine-rich repeat 159..182 CDD:275380 9/46 (20%)
leucine-rich repeat 183..206 CDD:275380 6/22 (27%)
leucine-rich repeat 207..230 CDD:275380 9/22 (41%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
PCC 259..>339 CDD:188093 15/79 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.