Sequence 1: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848665.1 | Gene: | RTN4RL2 / 349667 | HGNCID: | 23053 | Length: | 420 | Species: | Homo sapiens |
Alignment Length: | 333 | Identity: | 106/333 - (31%) |
---|---|---|---|
Similarity: | 153/333 - (45%) | Gaps: | 74/333 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 GIRGPLQA----------LGLP----------------------GNALMSVPWNALSTLSALERL 252
Fly 253 DLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSL--- 314
Fly 315 --RSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSL 377
Fly 378 RHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLP 442
Fly 443 SLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAEWLQESQLHSSLSASCVTP 507
Fly 508 PRLEGAPL 515 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | 44/150 (29%) |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | 1/2 (50%) | ||
leucine-rich repeat | 225..248 | CDD:275380 | 12/54 (22%) | ||
LRR_8 | 249..307 | CDD:290566 | 23/57 (40%) | ||
leucine-rich repeat | 249..272 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | <270..479 | CDD:238064 | 69/213 (32%) | ||
leucine-rich repeat | 273..296 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 297..322 | CDD:275380 | 10/29 (34%) | ||
LRR_8 | 322..382 | CDD:290566 | 16/59 (27%) | ||
leucine-rich repeat | 323..347 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 370..428 | CDD:290566 | 23/57 (40%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 418..478 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 476..526 | CDD:214507 | 17/40 (43%) | ||
RTN4RL2 | NP_848665.1 | LRR_8 | 60..117 | CDD:290566 | 22/58 (38%) |
leucine-rich repeat | 62..83 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | 103..>261 | CDD:238064 | 59/188 (31%) | ||
LRR_8 | 108..167 | CDD:290566 | 20/65 (31%) | ||
leucine-rich repeat | 108..132 | CDD:275380 | 10/26 (38%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 6/26 (23%) | ||
LRR_8 | 156..215 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 181..204 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 204..262 | CDD:290566 | 26/81 (32%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 9/22 (41%) | ||
TPKR_C2 | 261..311 | CDD:301599 | 17/40 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4913 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |