Sequence 1: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
Alignment Length: | 269 | Identity: | 71/269 - (26%) |
---|---|---|---|
Similarity: | 115/269 - (42%) | Gaps: | 29/269 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 296 KLEVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLPG-------MRNLESLNL 353
Fly 354 NRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLS 418
Fly 419 RLTVLDLTHNFLRALTSDLIAPL-PSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDC 482
Fly 483 SIRPFAEWLQESQLHSSLSASCVTPPRLEGAPLLQVPVETLSC---------DMDNVEKDNANIM 538
Fly 539 QHLETLAKP 547 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | 13/37 (35%) |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | |||
leucine-rich repeat | 225..248 | CDD:275380 | |||
LRR_8 | 249..307 | CDD:290566 | 5/10 (50%) | ||
leucine-rich repeat | 249..272 | CDD:275380 | |||
LRR_RI | <270..479 | CDD:238064 | 51/190 (27%) | ||
leucine-rich repeat | 273..296 | CDD:275380 | 71/269 (26%) | ||
leucine-rich repeat | 297..322 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 322..382 | CDD:290566 | 17/66 (26%) | ||
leucine-rich repeat | 323..347 | CDD:275380 | 6/30 (20%) | ||
leucine-rich repeat | 348..371 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 370..428 | CDD:290566 | 16/57 (28%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 418..478 | CDD:290566 | 17/60 (28%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 476..526 | CDD:214507 | 16/58 (28%) | ||
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 42/167 (25%) |
leucine-rich repeat | 112..137 | CDD:275380 | 7/35 (20%) | ||
LRR_8 | 137..196 | CDD:290566 | 17/58 (29%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 184..245 | CDD:290566 | 19/60 (32%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 267..316 | CDD:214507 | 15/48 (31%) | ||
IG_like | 328..428 | CDD:214653 | 5/20 (25%) | ||
Ig | 335..425 | CDD:143165 | 2/13 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24366 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |