DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and kek1

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster


Alignment Length:574 Identity:126/574 - (21%)
Similarity:199/574 - (34%) Gaps:187/574 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 EVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLN-----------GPLSEQTLPGMRNLESL 351
            :||.:.||:|           |.||..|. ::||.||           |.:..:|..|:.||..|
  Fly   124 QVLDMSGNKL-----------QTLSNEQF-IRANLLNLQKLYLRNCKIGEIERETFKGLTNLVEL 176

  Fly   352 NLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQH 416
            :|:.||:.::.:.||.:...|..|:|..|.|..::..||....:|..||||:..|..||:.:...
  Fly   177 DLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGG 241

  Fly   417 LSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCD 481
            |..||:                        |||.||.:|.:....::....|..:::.:||..||
  Fly   242 LQGLTL------------------------LRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCD 282

  Fly   482 CSIRPFAEWLQESQLHSSLSASCV-TPPRLEGAPLLQVPVETLSCD---------MDNVEKDNAN 536
            |.:|....||.:..:...::..|. .|.|:.......:.|:..:|.         ::....:||:
  Fly   283 CRLRDTKLWLMKRNIPYPVAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENAS 347

  Fly   537 I-----------------------------------MQHLE---------TLAKPNQTSPIKDLS 557
            |                                   ::.:|         .|....:|    |.|
  Fly   348 ITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQET----DSS 408

  Fly   558 EEIILHE-----------LHFS--------------TDYGLILTWLLNLSKKDYMCDAIFVYKEE 597
            |...:.|           ||.|              ......|..|:..:....||..:.|.::.
  Fly   409 EFYCVAENRAGMAEANFTLHVSMRAAGMASLGSGQIVGLSAALVALIVFALGVIMCLLLRVKRQP 473

  Fly   598 HINEILIDNSPIHCE-SKVVNGQNTV-SVIVPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSN 660
            :::    ..:|.|.| ...||.||:: :...|.:.:..||.      |:|......:.::.|...
  Fly   474 YVD----SKTPNHMEVITSVNHQNSITNKTQPATGNGSIGG------VVIANGAVANIIDGGVVQ 528

  Fly   661 ITRLERSSPGAVPVSRQYQRRPYYNANELKPEVVHDAGEDYQVNQRRFNSVVGSQPQQTQQSTLL 725
            ...|||.|.|...|                |..|||        ||..|. |...|:.|.   |.
  Fly   529 GGTLERKSSGRGGV----------------PHGVHD--------QRSANP-VQKPPRLTD---LP 565

  Fly   726 HSYTVIDSLNKSFLPGLGLGVLVTSVLVLIWGATRIRQTGGSSGGGGRNGDSID 779
            :|....|: |.|        ||.|        |:......||:|.||.|.|.|:
  Fly   566 YSTQGYDN-NGS--------VLST--------ASCFISPSGSTGNGGNNPDLIN 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 11/35 (31%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566 4/8 (50%)
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 51/191 (27%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380 6/23 (26%)
LRR_8 322..382 CDD:290566 21/70 (30%)
leucine-rich repeat 323..347 CDD:275380 8/34 (24%)
leucine-rich repeat 348..371 CDD:275380 7/22 (32%)
LRR_8 370..428 CDD:290566 18/57 (32%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 418..478 CDD:290566 10/59 (17%)
leucine-rich repeat 420..443 CDD:275380 2/22 (9%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRRCT 476..526 CDD:214507 12/50 (24%)
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380
LRR_RI <119..277 CDD:238064 49/188 (26%)
leucine-rich repeat 123..148 CDD:275380 11/35 (31%)
LRR_8 148..207 CDD:290566 16/58 (28%)
leucine-rich repeat 149..172 CDD:275380 3/22 (14%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 195..255 CDD:290566 23/83 (28%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
leucine-rich repeat 221..244 CDD:275380 9/22 (41%)
leucine-rich repeat 245..268 CDD:275380 8/46 (17%)
LRRCT 277..327 CDD:214507 12/49 (24%)
IG_like 338..429 CDD:214653 11/94 (12%)
Ig 346..426 CDD:143165 9/83 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.