DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Islr2

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001155007.1 Gene:Islr2 / 320563 MGIID:2444277 Length:789 Species:Mus musculus


Alignment Length:423 Identity:107/423 - (25%)
Similarity:167/423 - (39%) Gaps:103/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 LPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGI 406
            ||.  |:.:|:|:.|.|..::..|..|.:::.||.|.|:::..::..|...|..|.:||||:|.|
Mouse    93 LPA--NVTTLSLSANKITVLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHNLI 155

  Fly   407 VAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESL 471
            .....:.|::||.|.:|.:.||.|.:|..|.:..||.||.||:..|.:..:.....|....|..|
Mouse   156 SNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFDALSALSHL 220

  Fly   472 QMQENPLSCDCSIRPFAEWLQ--ESQLHSSL----SASCVTPPRLEGAPLLQVPVETLSCDMDNV 530
            |:..||..|.|.:    .|||  .:....||    |.:|.:||.|:|.|:.::|  .|.|...:|
Mouse   221 QLYHNPFHCSCGL----VWLQAWAASTRVSLPEPDSIACASPPELQGVPVHRLP--ALPCAPPSV 279

  Fly   531 EKDNANIMQHLETLAKPNQTSPIKDLSEEI--ILH---ELHFSTDYGLILTWLLNLSKKDYMCDA 590
            ...           |:|...:|...|...:  :||   |.|.:..    |.|.|.:.....:...
Mouse   280 RLS-----------AEPPPEAPGTPLRAGLAFMLHCVAEGHPTPR----LQWQLQIPGGTVVLVP 329

  Fly   591 IFVYKEEHINEILIDNS-------PIHCES-------------------KVVNGQNTVSVIVPDS 629
            ..:.|||...:.:.|..       |...|:                   .:.||    |::||..
Mouse   330 PVLSKEEDGGDKVEDGEGDGDEDLPTQTEAPTPTPAPAWPAPPATPRFLALANG----SLLVPLL 390

  Fly   630 SSLEIGESYRFCLVMIQEQKPDSELNIGCSNITRLERSSPGAVPVSRQYQRRPYYNANELKPEVV 694
            |:.|.|         |...:..:||.   :|.|.|..:...|.|                 |:..
Mouse   391 SAKEAG---------IYTCRAHNELG---TNSTSLRVTVAAAGP-----------------PKHA 426

  Fly   695 HDAGE--DYQV--------NQRRFNSVVGSQPQ 717
            ...||  |.||        .:.|.|||:..:|:
Mouse   427 PGTGEEPDAQVPTSERKATTKGRSNSVLPFKPE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 45/136 (33%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
LRR_8 322..382 CDD:290566 13/39 (33%)
leucine-rich repeat 323..347 CDD:275380 2/4 (50%)
leucine-rich repeat 348..371 CDD:275380 6/22 (27%)
LRR_8 370..428 CDD:290566 18/57 (32%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 418..478 CDD:290566 20/59 (34%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRRCT 476..526 CDD:214507 18/55 (33%)
Islr2NP_001155007.1 leucine-rich repeat 80..96 CDD:275380 2/4 (50%)
LRR_8 96..155 CDD:290566 19/58 (33%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR_4 144..183 CDD:289563 15/38 (39%)
leucine-rich repeat 145..168 CDD:275380 9/22 (41%)
LRR_8 164..227 CDD:290566 21/62 (34%)
LRR_4 169..208 CDD:289563 14/38 (37%)
leucine-rich repeat 169..192 CDD:275380 8/22 (36%)
leucine-rich repeat 193..216 CDD:275380 6/22 (27%)
LRRCT 225..273 CDD:214507 17/53 (32%)
Ig_2 288..417 CDD:290606 29/148 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.