DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Islr

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_006511267.1 Gene:Islr / 26968 MGIID:1349645 Length:436 Species:Mus musculus


Alignment Length:360 Identity:88/360 - (24%)
Similarity:134/360 - (37%) Gaps:99/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 PGM-RNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGI 406
            ||. .|:.:|:|:.|.:..:...|......|.||.|.||:|..:...|...|..|.|||||:|.:
Mouse    54 PGFPANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLL 118

  Fly   407 VAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESL 471
            ...:.:.|.:||.|.:|.:..|.|..:..|..:.|.:||.|:|..|.:..:|.........|..|
Mouse   119 SEFAWSDLHNLSALQLLKMDSNELAFIPRDAFSSLSALRSLQLNHNRLHALAEGTFAPLTALSHL 183

  Fly   472 QMQENPLSCDCSIRPFAEWLQESQLHSSLS------ASCVTPPRLEGAPLLQVPVETLSCDMDNV 530
            |:.:||..|.|.|..|..|    .|.|::|      .:|.||..|:|.||.::|  .|.|...:|
Mouse   184 QINDNPFDCTCGIVWFKTW----ALASAVSIPEQDNIACTTPHVLKGIPLGRLP--PLPCSAPSV 242

  Fly   531 EKDNANIMQHLETLAKPNQTSPIKDLSEEIILHELHFSTDYGLILTWLLNLSKKDYMCDAIFVYK 595
            :..           .:|:|..  .:|....:| .||                     ||      
Mouse   243 QLS-----------YQPSQDG--AELRPGFVL-ALH---------------------CD------ 266

  Fly   596 EEHINEILIDNSPI---HCESKVVNGQNTVSVIVPDSSSLEIGESYRFCLVMIQEQKPDSELNIG 657
                    :|..|:   |.......|  ||.:..|                           |:|
Mouse   267 --------VDGQPVPQLHWHIHTPGG--TVEIASP---------------------------NVG 294

  Fly   658 CSNITRLERSSPGAVPVSRQYQRRPYYNANELKPE 692
            ...     |:.|||:..|.|.:.:.:.|.:.|.|:
Mouse   295 TDG-----RALPGALATSGQPRFQAFANGSLLIPD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 43/136 (32%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
LRR_8 322..382 CDD:290566 13/39 (33%)
leucine-rich repeat 323..347 CDD:275380 2/4 (50%)
leucine-rich repeat 348..371 CDD:275380 4/22 (18%)
LRR_8 370..428 CDD:290566 21/57 (37%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 418..478 CDD:290566 17/59 (29%)
leucine-rich repeat 420..443 CDD:275380 6/22 (27%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRRCT 476..526 CDD:214507 19/55 (35%)
IslrXP_006511267.1 leucine-rich repeat 40..59 CDD:275380 2/4 (50%)
LRR_8 59..118 CDD:338972 21/58 (36%)
leucine-rich repeat 60..83 CDD:275380 4/22 (18%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
LRR_8 107..166 CDD:338972 21/58 (36%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
PCC 161..>235 CDD:188093 24/79 (30%)
Ig 263..349 CDD:319273 22/131 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.