DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Rtn4rl2

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_006499655.1 Gene:Rtn4rl2 / 269295 MGIID:2669796 Length:480 Species:Mus musculus


Alignment Length:288 Identity:97/288 - (33%)
Similarity:143/288 - (49%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 NALMSVPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKL 297
            |...|||   ||...:.:||.|.||.|::|....|.  .:|:.|.|.:|.:|:|...||.:|:.|
Mouse   109 NNFSSVP---LSLPPSTQRLFLQNNLIRSLRPGTFG--PNLLTLWLFSNNLSTIHPGTFRHLQAL 168

  Fly   298 EVLKLGGNRLGDYAQSL-----RSLSQCLSLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNL 357
            |.|.||.||   :.:||     :.|.:..||.....|.::|.|.:    ..|:.:|:.|.|..|.
Mouse   169 EELDLGDNR---HLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNI----FRGLVSLQYLYLQENS 226

  Fly   358 IKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTV 422
            :..:|:...|:.:.|..|.|..|::.:|.:|.|.|||:||.|.|..|.:..:..|:...|||||:
Mouse   227 LLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTI 291

  Fly   423 LDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPF 487
            |.|.:|.|.:|..:.:|.||:|..|||          ||              ||.:|||..||.
Mouse   292 LYLFNNSLASLPGEALADLPALEFLRL----------NA--------------NPWACDCRARPL 332

  Fly   488 AEWLQESQLHSSLSASCVTPPRLEGAPL 515
            ..|.|.:::.|| ..:|.|||..:|..|
Mouse   333 WAWFQRARVSSS-DVTCATPPERQGRDL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 36/105 (34%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380 6/14 (43%)
LRR_8 249..307 CDD:290566 23/57 (40%)
leucine-rich repeat 249..272 CDD:275380 8/22 (36%)
LRR_RI <270..479 CDD:238064 68/213 (32%)
leucine-rich repeat 273..296 CDD:275380 9/22 (41%)
leucine-rich repeat 297..322 CDD:275380 10/29 (34%)
LRR_8 322..382 CDD:290566 16/59 (27%)
leucine-rich repeat 323..347 CDD:275380 5/23 (22%)
leucine-rich repeat 348..371 CDD:275380 6/22 (27%)
LRR_8 370..428 CDD:290566 23/57 (40%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 7/22 (32%)
LRR_8 418..478 CDD:290566 19/59 (32%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRRCT 476..526 CDD:214507 17/40 (43%)
Rtn4rl2XP_006499655.1 leucine-rich repeat 122..143 CDD:275380 8/22 (36%)
LRR_8 143..203 CDD:338972 21/62 (34%)
leucine-rich repeat 144..167 CDD:275380 9/22 (41%)
leucine-rich repeat 168..192 CDD:275380 10/26 (38%)
leucine-rich repeat 193..216 CDD:275380 6/26 (23%)
LRR_8 216..275 CDD:338972 21/58 (36%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..264 CDD:275380 9/22 (41%)
LRR_8 264..322 CDD:338972 25/81 (31%)
leucine-rich repeat 265..288 CDD:275380 7/22 (32%)
leucine-rich repeat 289..312 CDD:275380 9/22 (41%)
LRRCT 321..371 CDD:214507 17/40 (43%)
PHA03247 349..>429 CDD:223021 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4913
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.