DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and LRRN4CL

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_981967.1 Gene:LRRN4CL / 221091 HGNCID:33724 Length:238 Species:Homo sapiens


Alignment Length:267 Identity:47/267 - (17%)
Similarity:75/267 - (28%) Gaps:121/267 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 PVETLSCDMDNVEKDNANIMQHLETLAK------------PNQTSPIKD-----LSEEIILHE-- 564
            |:..:.||.|:        .:||:...|            |..:||.:.     :.|..|..|  
Human    42 PLPAVPCDYDH--------CRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEG 98

  Fly   565 ---LHFSTDYGLIL-TWLLNLSKKDYMCDAIFVYKEEHINEILIDNSPIHCESKVVNGQNTVSVI 625
               :|:...:..:| .|||                       |.|.|....:...:|    .:|.
Human    99 RAVVHWCAPFSPVLHYWLL-----------------------LWDGSEAAQKGPPLN----ATVR 136

  Fly   626 VPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSNITR-----LERSS-PGAVPVSRQYQRRPYY 684
            ..:...|:.|..|..|:|...|        .|.|.:.:     ||.:. |...|.||        
Human   137 RAELKGLKPGGIYVVCVVAANE--------AGASRVPQAGGEGLEGADIPAFGPCSR-------- 185

  Fly   685 NANELKPEVVHDAGEDYQVNQRRFNSVVGSQPQQTQQSTLLHSYTVIDSLNKSFLPGLGLGVLVT 749
                                     ..|...|:     ||:|:..           |:|..:.:.
Human   186 -------------------------LAVPPNPR-----TLVHAAV-----------GVGTALALL 209

  Fly   750 SVLVLIW 756
            |...|:|
Human   210 SCAALVW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
LRR_8 322..382 CDD:290566
leucine-rich repeat 323..347 CDD:275380
leucine-rich repeat 348..371 CDD:275380
LRR_8 370..428 CDD:290566
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..419 CDD:275380
LRR_8 418..478 CDD:290566
leucine-rich repeat 420..443 CDD:275380
leucine-rich repeat 444..467 CDD:275380
LRRCT 476..526 CDD:214507 1/6 (17%)
LRRN4CLNP_981967.1 FN3 83..162 CDD:238020 20/113 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.