Sequence 1: | NP_001286640.1 | Gene: | Lrt / 37342 | FlyBaseID: | FBgn0034540 | Length: | 830 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_981967.1 | Gene: | LRRN4CL / 221091 | HGNCID: | 33724 | Length: | 238 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 47/267 - (17%) |
---|---|---|---|
Similarity: | 75/267 - (28%) | Gaps: | 121/267 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 519 PVETLSCDMDNVEKDNANIMQHLETLAK------------PNQTSPIKD-----LSEEIILHE-- 564
Fly 565 ---LHFSTDYGLIL-TWLLNLSKKDYMCDAIFVYKEEHINEILIDNSPIHCESKVVNGQNTVSVI 625
Fly 626 VPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSNITR-----LERSS-PGAVPVSRQYQRRPYY 684
Fly 685 NANELKPEVVHDAGEDYQVNQRRFNSVVGSQPQQTQQSTLLHSYTVIDSLNKSFLPGLGLGVLVT 749
Fly 750 SVLVLIW 756 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrt | NP_001286640.1 | LRR_RI | <151..334 | CDD:238064 | |
leucine-rich repeat | 179..199 | CDD:275378 | |||
leucine-rich repeat | 200..223 | CDD:275380 | |||
leucine-rich repeat | 225..248 | CDD:275380 | |||
LRR_8 | 249..307 | CDD:290566 | |||
leucine-rich repeat | 249..272 | CDD:275380 | |||
LRR_RI | <270..479 | CDD:238064 | |||
leucine-rich repeat | 273..296 | CDD:275380 | |||
leucine-rich repeat | 297..322 | CDD:275380 | |||
LRR_8 | 322..382 | CDD:290566 | |||
leucine-rich repeat | 323..347 | CDD:275380 | |||
leucine-rich repeat | 348..371 | CDD:275380 | |||
LRR_8 | 370..428 | CDD:290566 | |||
leucine-rich repeat | 372..395 | CDD:275380 | |||
leucine-rich repeat | 396..419 | CDD:275380 | |||
LRR_8 | 418..478 | CDD:290566 | |||
leucine-rich repeat | 420..443 | CDD:275380 | |||
leucine-rich repeat | 444..467 | CDD:275380 | |||
LRRCT | 476..526 | CDD:214507 | 1/6 (17%) | ||
LRRN4CL | NP_981967.1 | FN3 | 83..162 | CDD:238020 | 20/113 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |