DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and Pkd1

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_036016298.1 Gene:Pkd1 / 18763 MGIID:97603 Length:4316 Species:Mus musculus


Alignment Length:348 Identity:81/348 - (23%)
Similarity:123/348 - (35%) Gaps:64/348 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 SLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENP 477
            ||:..:..|.|||:||.|:.|...|:..|.:|.||.|:.|.||.:..........|..:.:..||
Mouse    62 SLRIPADATALDLSHNLLQTLDIGLLVNLSALVELDLSNNRISTLEEGVFANLFNLSEINLSGNP 126

  Fly   478 LSCDCSIRPFAEWLQESQLH--SSLSASCVTPPRLEGAPLLQVPVETLSCDMDNVEKDNANIMQH 540
            ..|:|.:.....|.:|.|:|  .|.:.:|..|..|.|.|||.:|:           .|||...::
Mouse   127 FECNCGLAWLPRWAKEHQVHVVQSEATTCRGPIPLAGQPLLSIPL-----------LDNACGEEY 180

  Fly   541 LETLAKPNQTSPIKDLSEEIILHELHFSTDYGLILTWLLNLSKKDYMCDAIFVYKEEHINEILID 605
            :..|  |:.:|...........||....|:                .|.|......|.:..:...
Mouse   181 VACL--PDNSSGAVAAVPFYFAHEGPLETE----------------ACSAFCFSAGEGLAALSEQ 227

  Fly   606 NSPIHCESKVVNGQNTVSVIVPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSNITRLER---S 667
            |   .|........|:.:......||:.:                  .||..|...|.|:.   :
Mouse   228 N---QCLCGAGQASNSSAACSSWCSSISL------------------SLNSACGGPTLLQHTFPA 271

  Fly   668 SPGAVPVSRQYQRRPYYNANELKPEVVHDAGEDYQVNQRRFNSVVGSQPQQTQQSTLLHSYTVID 732
            ||||..|.      |:......:|...| ......::..|:|...||...........|.|.:..
Mouse   272 SPGATLVG------PHGPLASGQPADFH-ITSSLPISSTRWNFGDGSPEVDMASPAATHFYVLPG 329

  Fly   733 SLNKSFLPGLGLG--VLVTSVLV 753
            |.:.:.:..||.|  :|.|.|.|
Mouse   330 SYHMTVVLALGAGSALLETEVQV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 22/65 (34%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
LRR_8 322..382 CDD:290566
leucine-rich repeat 323..347 CDD:275380
leucine-rich repeat 348..371 CDD:275380
LRR_8 370..428 CDD:290566 6/14 (43%)
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..419 CDD:275380 2/5 (40%)
LRR_8 418..478 CDD:290566 19/59 (32%)
leucine-rich repeat 420..443 CDD:275380 10/22 (45%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRRCT 476..526 CDD:214507 17/51 (33%)
Pkd1XP_036016298.1 LRRNT 32..71 CDD:214470 2/8 (25%)
LRR_8 61..127 CDD:404697 21/64 (33%)
leucine-rich repeat 70..92 CDD:275378 10/21 (48%)
leucine-rich repeat 93..116 CDD:275378 7/22 (32%)
PCC 97..2731 CDD:188093 66/313 (21%)
leucine-rich repeat 117..129 CDD:275378 3/11 (27%)
GPS 3011..3060 CDD:413374
PLAT_polycystin 3118..3237 CDD:238850
PKD_channel 3726..4126 CDD:400395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8331
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.