DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and tril

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_002933436.2 Gene:tril / 100498304 XenbaseID:XB-GENE-6050227 Length:872 Species:Xenopus tropicalis


Alignment Length:702 Identity:172/702 - (24%)
Similarity:252/702 - (35%) Gaps:196/702 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TGTRNAELEC--GCDLPHTLRCNIDLHGMMLLADR-LRTSPYSISLLDCSLRNVTFLSDAKIFDN 197
            |..|:.|.:|  .||..|...        :|.::| |.:.|.|..:|..|... ||........|
 Frog    16 TLARSVEPKCLEPCDCQHQQH--------VLCSNRGLLSVPKSSHMLSSSATK-TFSLGGNFIAN 71

  Fly   198 VS---------LHGLVISSGEIKRVHKSAF---------------LGIRGP--------LQALGL 230
            :|         |..|.:....|..:|..||               |....|        |:.|.:
 Frog    72 ISALDFVQFPQLQRLDLQYNRIGSIHPKAFEKLTELEELYLGNNLLATLAPGALAPLRKLKVLNV 136

  Fly   231 PGNALMSVPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLELSNNQISSISQRTFVNLR 295
            .||.|.::...:.|.|:||.:|.|..|.|:.|..:.|..|::|:||.|.||:|::||:..|..|.
 Frog   137 NGNRLHNISRVSFSNLAALIKLRLDGNDIQNLQGSPFSALSNLLYLHLENNKITNISKNAFTGLG 201

  Fly   296 KLEVLKLGGNRLGDYAQSLRSLSQCLSLRQLD--LQANNLNGPLSEQTLPGMRNLESLNLNRNLI 358
            ||.:|.|.||     .||.......|.||.|.  ..|.|....|......|::.|..|.|:.|.|
 Frog   202 KLRLLSLSGN-----PQSFLRQPTFLPLRALSTLTMAGNQLQQLGPSLFNGLQRLSRLVLSSNQI 261

  Fly   359 KSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVL 423
            ..||.|.......|..|.|..|::..|.:.....|..|:.|:||.|.|..:...:.:.|.||.||
 Frog   262 SVIQTKTFLGLDLLQELHLDGNKLVQLPEGVLVPLHNLEVLNLSRNAISHLHPETFKGLMRLRVL 326

  Fly   424 DLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFA 488
            ||.||.||.|:....|..|.|..|:|.|                        |..||||.:....
 Frog   327 DLQHNMLRYLSGQTFAGNPVLYRLQLDG------------------------NRWSCDCQLLDLK 367

  Fly   489 EWLQESQLHS-----SLSASCVTPPRLEG-----------------------APLLQVPVETLS- 524
            .|:. ..|||     ::...|..|.::.|                       |...|:...||| 
 Frog   368 HWIL-GTLHSRSRMLTVFVQCFEPQKVAGKYLDYLEDSYLWDVGGCRISTTPAGQEQMMTSTLSD 431

  Fly   525 ----------CDMDNV---EKDNANIMQHLE--TLAKPNQTSPIKDLSEEIILHELHFSTDYGLI 574
                      .|:|.:   ..||..:....|  :|..|...|.:....|.:.|.:      ..|:
 Frog   432 GNIGVHQARKGDIDLIVVTGADNLRVQPKTEEKSLQLPTPPSEVSPALETLALRQ------QALV 490

  Fly   575 LTWLLNLSK-----------------KDYMCDAIFVYKEEHINEILIDNSPIH-CESKVVNGQNT 621
            ..|..:.:|                 |.....|      ||..::.:...|:| .:|||    ..
 Frog   491 TKWPSSTNKDGTAKNRGLETSRKGKGKSVKNSA------EHSRKLHLVAQPVHPTQSKV----KQ 545

  Fly   622 VSVIVPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSNITRLERSSPGAVPVSRQYQRRPYYNA 686
            |||::|.||:|                .|:|| ::......||:  :|..||           |.
 Frog   546 VSVLIPASSNL----------------PPNSE-SMHSEKPVRLD--TPSVVP-----------NL 580

  Fly   687 NELK---PEVVHDAGEDYQVNQRRFNSVVGSQPQQTQQSTLLHSYTVIDSLN 735
            .:::   ..:.||...|..::.        ..| .|:...|.||.|::.:.|
 Frog   581 EDVRSVFTTLQHDDTTDKPIHH--------DNP-ATKTLHLSHSDTLLPNYN 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 61/217 (28%)
leucine-rich repeat 179..199 CDD:275378 5/19 (26%)
leucine-rich repeat 200..223 CDD:275380 7/37 (19%)
leucine-rich repeat 225..248 CDD:275380 7/22 (32%)
LRR_8 249..307 CDD:290566 25/57 (44%)
leucine-rich repeat 249..272 CDD:275380 8/22 (36%)
LRR_RI <270..479 CDD:238064 67/210 (32%)
leucine-rich repeat 273..296 CDD:275380 11/22 (50%)
leucine-rich repeat 297..322 CDD:275380 7/24 (29%)
LRR_8 322..382 CDD:290566 19/61 (31%)
leucine-rich repeat 323..347 CDD:275380 7/25 (28%)
leucine-rich repeat 348..371 CDD:275380 8/22 (36%)
LRR_8 370..428 CDD:290566 19/57 (33%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 7/22 (32%)
LRR_8 418..478 CDD:290566 18/59 (31%)
leucine-rich repeat 420..443 CDD:275380 11/22 (50%)
leucine-rich repeat 444..467 CDD:275380 4/22 (18%)
LRRCT 476..526 CDD:214507 17/88 (19%)
trilXP_002933436.2 leucine-rich repeat 35..58 CDD:275378 6/30 (20%)
leucine-rich repeat 59..82 CDD:275380 4/23 (17%)
leucine-rich repeat 83..106 CDD:275380 6/22 (27%)
internalin_A 84..>375 CDD:380193 94/320 (29%)
leucine-rich repeat 107..130 CDD:275380 2/22 (9%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..202 CDD:275380 11/22 (50%)
leucine-rich repeat 203..226 CDD:275380 9/27 (33%)
leucine-rich repeat 227..250 CDD:275380 5/22 (23%)
leucine-rich repeat 251..274 CDD:275380 8/22 (36%)
leucine-rich repeat 275..298 CDD:275380 6/22 (27%)
leucine-rich repeat 299..320 CDD:275380 6/20 (30%)
leucine-rich repeat 323..346 CDD:275380 11/22 (50%)
fn3 662..737 CDD:394996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.