DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrt and lrit3b

DIOPT Version :9

Sequence 1:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:301 Identity:68/301 - (22%)
Similarity:103/301 - (34%) Gaps:123/301 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ALMSVPWNALSTLSALERLDLANNKIK---------ALGTADFVGLTSLVYLELSNNQISSISQR 289
            ||.::|            :||.|:.:|         .:....|..:..|:||.|:.|.||.:..|
Zfish    78 ALTAIP------------IDLPNDTVKFRLERTSVSRIFRGAFSAMPELLYLWLTYNSISVLHPR 130

  Fly   290 TFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLP--GMRNLESLN 352
            :|.||..|..|:|.||.|                                .|.|  |:|::    
Zfish   131 SFTNLSSLHELRLDGNLL--------------------------------STFPWEGLRDM---- 159

  Fly   353 LNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHL 417
                             .||.:|.| ||                       |.:..|...::::|
Zfish   160 -----------------PRLRTLGL-HN-----------------------NRLARIPLLAVRYL 183

  Fly   418 SRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDC 482
            ..:|.|||:.|.|..|.:||.|       |.|. :|.:...|:.:        |.:|:||..|||
Zfish   184 RNVTYLDLSSNRLSTLANDLTA-------LWLF-SDSNQTQRSFV--------LGLQDNPWVCDC 232

  Fly   483 SIRPFAEWLQESQLHSSL-----SASCVTPPRLEGAPLLQV 518
            .:....:..:..:  |||     ..:|..|..|.|.|...|
Zfish   233 RLSTLLDISRGPE--SSLVLLDRFLTCSEPLDLAGVPFQSV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 25/108 (23%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380 3/13 (23%)
LRR_8 249..307 CDD:290566 21/66 (32%)
leucine-rich repeat 249..272 CDD:275380 5/31 (16%)
LRR_RI <270..479 CDD:238064 48/210 (23%)
leucine-rich repeat 273..296 CDD:275380 11/22 (50%)
leucine-rich repeat 297..322 CDD:275380 6/24 (25%)
LRR_8 322..382 CDD:290566 10/61 (16%)
leucine-rich repeat 323..347 CDD:275380 3/25 (12%)
leucine-rich repeat 348..371 CDD:275380 0/22 (0%)
LRR_8 370..428 CDD:290566 13/57 (23%)
leucine-rich repeat 372..395 CDD:275380 5/22 (23%)
leucine-rich repeat 396..419 CDD:275380 3/22 (14%)
LRR_8 418..478 CDD:290566 17/59 (29%)
leucine-rich repeat 420..443 CDD:275380 10/22 (45%)
leucine-rich repeat 444..467 CDD:275380 4/22 (18%)
LRRCT 476..526 CDD:214507 14/48 (29%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470 6/25 (24%)
leucine-rich repeat 69..89 CDD:275380 5/22 (23%)
LRR_8 112..172 CDD:290566 28/136 (21%)
leucine-rich repeat 114..137 CDD:275378 11/22 (50%)
leucine-rich repeat 138..161 CDD:275378 10/75 (13%)
LRR_8 160..214 CDD:290566 22/85 (26%)
LRR_4 160..201 CDD:289563 16/64 (25%)
leucine-rich repeat 162..185 CDD:275378 8/46 (17%)
leucine-rich repeat 186..199 CDD:275378 6/12 (50%)
leucine-rich repeat 215..230 CDD:275378 5/22 (23%)
Ig 278..391 CDD:299845
I-set 279..391 CDD:254352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.