DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and LYZL1

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 / 84569 HGNCID:30502 Length:185 Species:Homo sapiens


Alignment Length:140 Identity:44/140 - (31%)
Similarity:68/140 - (48%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGGALFLVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSY---LSNWVCLVEAESGRSTSKSM 68
            |...:..::..|:..   .|||:.|||:|||...|......:   |.||:|:...|||.:|:...
Human    48 KAAGILTLIGCLVTG---AESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQT 109

  Fly    69 QLPNQSVSYGLFQINSKNWCRKG--RRGGICNIKCEEFLNDEISDDSRCAMQIFNR-HGFQAW-- 128
            .|.:.|:.||:|||||..|||:|  :....|::.|...:.|:::|...||.:|... .|...|  
Human   110 VLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWSL 174

  Fly   129 ----PGWMSK 134
                |.:..|
Human   175 LLRIPNYKGK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 40/119 (34%)
LYZL1XP_005252684.1 LYZ1 66..172 CDD:238066 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153997
Domainoid 1 1.000 91 1.000 Domainoid score I7672
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.