DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Spaca3

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001346112.1 Gene:Spaca3 / 75622 MGIID:1922872 Length:163 Species:Mus musculus


Alignment Length:146 Identity:56/146 - (38%)
Similarity:81/146 - (55%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALFLVLNLLLLSQWETESKLLTRCQLAKELLRHDFP----RSY-LSNWVCLVEAESGRSTSKSMQ 69
            ||..:|:.||.|   :::|:.:||:||||:  |||.    |.| |::||||....||.:|:....
Mouse    21 ALAYLLSCLLAS---SKAKVFSRCELAKEM--HDFGLDGYRGYNLADWVCLAYYTSGFNTNAVDH 80

  Fly    70 LPNQSVSYGLFQINSKNWCRKGRRGG--ICNIKCEEFLNDEISDDSRCAMQIFNRH-GFQAWPGW 131
            ..:.|.:.|:|||:|:.|||.....|  :|.|.|.:.||:::.|...|||:|.... |...|..|
Mouse    81 EADGSTNNGIFQISSRRWCRTLASNGPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAW 145

  Fly   132 MSKCRGRTLPD-VSRC 146
            ...|:||.|.| |..|
Mouse   146 RHHCQGRDLSDWVDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 49/126 (39%)
Spaca3NP_001346112.1 LYZ1 36..159 CDD:238066 48/124 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844236
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.