DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lyzl6

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 / 69444 MGIID:1916694 Length:148 Species:Mus musculus


Alignment Length:138 Identity:46/138 - (33%)
Similarity:68/138 - (49%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALFL-VLNLLLLSQWETESKLLTRCQLAKELLRHD---FPRSYLSNWVCLVEAESGRSTSKSMQL 70
            |||: |.:.||:   ..:..::.||.|||.|...|   |....|.:|:||...||..:.||..:.
Mouse     4 ALFICVASCLLV---VNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNEN 65

  Fly    71 PNQSVSYGLFQINSKNWCR--KGRRGGICNIKCEEFLNDEISDDSRCAMQIFN-RHGFQAWPGWM 132
            .:.|..||:|||||:.||.  :......|::.|:|.|:..:.....||.:|.: ..|.:.|..|.
Mouse    66 VDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWK 130

  Fly   133 SKCRGRTL 140
            ..|.||.|
Mouse   131 LHCLGRPL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 40/119 (34%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 40/118 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.