DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lyzl4

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001344275.2 Gene:Lyzl4 / 69032 MGIID:1916282 Length:145 Species:Mus musculus


Alignment Length:142 Identity:53/142 - (37%)
Similarity:72/142 - (50%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLVLNLLLLSQWETE--SKLLTRCQLAKELLRHDFPRSY-----LSNWVCLVEAESGRSTSKSM 68
            |:||  |||:|...|.  :.:|.||.:||.|  :|...:|     |.|||||...||..:.|...
Mouse     3 LYLV--LLLISYLLTPIGASILGRCTVAKML--YDGGLNYFEGYSLENWVCLAYFESKFNPSAVY 63

  Fly    69 QLPNQ-SVSYGLFQINSKNWCRKGRRGGICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGW 131
            :.|.. |..:|||||....||..|:  .:|::.|...||..:.|..:||.:|. .:||..|||.|
Mouse    64 EDPQDGSTGFGLFQIRDNEWCGHGK--NLCSVSCTALLNPNLKDTIQCAKKIVKGKHGMGAWPIW 126

  Fly   132 MSKCRGRTLPDV 143
            ...|:   |.||
Mouse   127 SKNCQ---LSDV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 45/123 (37%)
Lyzl4NP_001344275.2 LYZ_C 21..143 CDD:340383 45/122 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.