DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and Lyc2

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001381322.1 Gene:Lyc2 / 688047 RGDID:1593616 Length:148 Species:Rattus norvegicus


Alignment Length:137 Identity:49/137 - (35%)
Similarity:70/137 - (51%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSY----LSNWVCLVEAESGRSTSK-SMQLPN 72
            |||..||||. ..::|:...|:||: :||......|    |.||:|:.:.||...|.. :....:
  Rat     5 LVLGFLLLSA-SVQAKVFKHCELAR-ILRSSALAGYRGVSLENWMCMAQHESNFDTEAINYNSTD 67

  Fly    73 QSVSYGLFQINSKNWCRKG---RRGGICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMS 133
            ||..||:|||||:.||..|   |....|.|.|...|.|:|:...:||.::. :..|.:||..|..
  Rat    68 QSTDYGIFQINSRYWCNDGKTPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQR 132

  Fly   134 KCRGRTL 140
            .|:.|.|
  Rat   133 HCQNRDL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 42/122 (34%)
Lyc2NP_001381322.1 LYZ1 19..147 CDD:197612 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.