DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and lyz

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_631919.1 Gene:lyz / 677744 ZFINID:ZDB-GENE-020515-2 Length:151 Species:Danio rerio


Alignment Length:133 Identity:44/133 - (33%)
Similarity:65/133 - (48%) Gaps:8/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLNLLLLSQWETESKLLTRCQLAKELLRHD----FPRSYLSNWVCLVEAESGRSTSKSMQLPNQS 74
            |:.|.|......|||.|.||.:.| :.:::    |....:.|:||....|| |..:..::..:..
Zfish     5 VVFLCLAWMSSCESKTLGRCDVYK-IFKNEGLDGFEGFSIGNYVCTAYWES-RFKTHRVRSADTG 67

  Fly    75 VSYGLFQINSKNWCRKGRRGG--ICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKCRG 137
            ..||:|||||..||..|..||  :|.:.|.:.|||::.....||..|....|.::|..|.|.|.|
Zfish    68 KDYGIFQINSFKWCDDGTPGGKNLCKVACSDLLNDDLKASVGCAKLIVKMDGLKSWETWDSYCNG 132

  Fly   138 RTL 140
            |.:
Zfish   133 RKM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 39/119 (33%)
lyzNP_631919.1 LYZ1 19..140 CDD:238066 39/119 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589131
Domainoid 1 1.000 81 1.000 Domainoid score I8440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122630
Inparanoid 1 1.050 86 1.000 Inparanoid score I5137
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - otm26024
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.