DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and LYZ

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_000230.1 Gene:LYZ / 4069 HGNCID:6740 Length:148 Species:Homo sapiens


Alignment Length:134 Identity:48/134 - (35%)
Similarity:76/134 - (56%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLR---HDFPRSYLSNWVCLVEAESGRST-SKSMQLPNQ 73
            :||.|:|||. ..:.|:..||:||:.|.|   ..:....|:||:||.:.|||.:| :.:....::
Human     5 IVLGLVLLSV-TVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDR 68

  Fly    74 SVSYGLFQINSKNWCRKGRRGG---ICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMSK 134
            |..||:|||||:.||..|:..|   .|::.|...|.|.|:|...||.::. :..|.:||..|.::
Human    69 STDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNR 133

  Fly   135 CRGR 138
            |:.|
Human   134 CQNR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 42/119 (35%)
LYZNP_000230.1 LYZ1 19..147 CDD:197612 42/119 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.