DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and SPACA5

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001381227.1 Gene:SPACA5 / 389852 HGNCID:31353 Length:159 Species:Homo sapiens


Alignment Length:136 Identity:46/136 - (33%)
Similarity:70/136 - (51%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLR---HDFPRSYLSNWVCLVEAESGRSTSKSMQLPNQS 74
            :|:.|..|.....::|:..||:||..|.|   :.:....:.:|:|:...|||..|:.....|:.|
Human     7 VVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGS 71

  Fly    75 VSYGLFQINSKNWCRKG--RRGGICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMSKCR 136
            ..||:||:||..||..|  ....:|::.|.:.||..|.||.|||.||. :::|..||..|...|.
Human    72 SEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHCS 136

  Fly   137 GRTLPD 142
            |..|.:
Human   137 GHDLSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 43/121 (36%)
SPACA5NP_001381227.1 LYZ_C 22..147 CDD:340383 43/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 1 0.950 - 0 Normalized mean entropy S7264
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.