DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and CG8492

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster


Alignment Length:135 Identity:49/135 - (36%)
Similarity:71/135 - (52%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQWETESKLLTRCQLAKEL-LRHDFPRSYLSNWVCLVEAESGRSTSKSMQL-PNQSVSYGLFQIN 83
            :.::...|:..||:||:|| ..|.||...|:.|||:.|.||..:|:...:| .:.|..:|||||:
  Fly   432 THYQRTGKVYNRCELAQELYFSHKFPMQDLATWVCIAEHESSFNTTAVGRLNADGSADHGLFQIS 496

  Fly    84 SKNWCRKGRRGGI-CNIKCEEFLNDEISDDSRCAMQIFNRH------GFQAWPGWMSKCRGRTLP 141
            ...||.....||. |:|.|...|:.:|:||.:|...|...|      ||.||..:...||.:|..
  Fly   497 DLYWCTHNDGGGKGCHIDCNRLLDSDITDDVKCVRTIHEEHTRISGDGFTAWTVYNGHCRQKTRA 561

  Fly   142 DVSRC 146
            ||:.|
  Fly   562 DVANC 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 48/126 (38%)
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066 48/126 (38%)
LYZ1 596..723 CDD:238066
PARM 937..>1068 CDD:293666
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26024
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.