DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and LysS

DIOPT Version :10

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster


Alignment Length:144 Identity:46/144 - (31%)
Similarity:67/144 - (46%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSYLSNWVCLVEAES-------GRSTSKSMQ 69
            |..|.||.::......:.|.||.||:|:.....||..|..|.|:.:.||       |.:.|    
  Fly     4 FFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANS---- 64

  Fly    70 LPNQSVSYGLFQINSKNWCRKGRRGGI--CNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWM 132
              :.|..||:||||...||:...|...  |.:.|...|.|:|::..|||.::.::.|:.||..| 
  Fly    65 --DGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVW- 126

  Fly   133 SKCRGRTLPDVSRC 146
            ..|.| .||.:..|
  Fly   127 HYCSG-WLPSIDEC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 41/126 (33%)
LysSNP_476829.1 LYZ_C_invert 20..139 CDD:381618 41/126 (33%)

Return to query results.
Submit another query.