DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11159 and LysP

DIOPT Version :9

Sequence 1:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster


Alignment Length:145 Identity:50/145 - (34%)
Similarity:77/145 - (53%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSYLSNWVCLVEAES-------GRSTSKSMQ 69
            |||:..|.|:...|:::.:.||.||:|:.:...||..|:.|.|:.:.||       |.:.|    
  Fly     4 FLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANS---- 64

  Fly    70 LPNQSVSYGLFQINSKNWCR--KGRRG-GICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGW 131
              |.|..||:||||:|.||:  .||.. ..|.:.|...|.|:|::..:||.:|..:.|:.||..|
  Fly    65 --NGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW 127

  Fly   132 MSKCRGRTLPDVSRC 146
             ..|.| :||.::.|
  Fly   128 -KYCSG-SLPSINSC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 43/127 (34%)
LysPNP_476828.1 LYZ1 20..141 CDD:197612 44/129 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4912
SonicParanoid 1 1.000 - - X173
87.890

Return to query results.
Submit another query.